SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001247 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001247
Domain Number 1 Region: 72-247
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-28
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 
Domain Number 2 Region: 333-454
Classification Level Classification E-value
Superfamily PH domain-like 8.92e-22
Family Pleckstrin-homology domain (PH domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001247   Gene: ENSGACG00000000961   Transcript: ENSGACT00000001248
Sequence length 814
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:1548001:1580184:-1 gene:ENSGACG00000000961 transcript:ENSGACT00000001248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELVCELRLFLDLLDREYLSAGIREKKMHLSNILNRVLSDKGEQKKEPSFKLDIHSGLP
APPQMPLPEIPHPWLPPTGPPPLPSSSLPEGYYEEAVPLSPGKAPEYITANYDSDAMSSS
YESYDEEEEDGKGQKMRHQWPSAEASMDLVKDARICAFLLRKKRFGQWAKLLCVIKDNKL
LCYKSSKDHTPQMELTLTGCTITHIPKDGKKKKHELKIIHQGADALVLAVHSKEQAEEWL
KVMREVCVNGGIDLDRAGSGSPVHKPELEKKSSCDRPSSDGEATHENGQGDQENSKKSTK
GKKNTKSEQKTGTVGKGAGKKITKIIGLGKKKPSTEEQTSSAEEEVPLCGYLNVLSNNRW
RERWCRLKDNQLLLHKDRDDLKSHIASLPLRGCEVSPGLDHKHPFAFRLLRNGQEVAVLE
ASSSEEMGRWLGILLAETGSTTDPATLHYDYIDVETTANVIQLAKQSFCFTSKRAVSLNP
YLDNPVNGYACPTGMALHYDDVPINGTDPGVQYSSPNTRGGQLNEEVHYENAELYENMPS
SKLDICYPPKLSSSSSSSASHYKSPVSKVSSKFLAADTKTKATAQGRGPIEQLKGKKGTA
TNGMASKQKTEPKNQTKKNGVNGTNGTASLKRNDSNAEQCKYGKNRVEADAKRLQVKEEE
LMKKKQEIRTHLTYLKKERRDLRTAVEAAAGKRSHASLSERLNKVEEDCRQKEQERVNME
LEMTEVKESLKKALSGGVTLGLTIEPKAGSSGIQQRCDGPRSLHPFSSCSDTESCSLPVN
SASLLRRQQGGQKASPVRGHVLRKAKEWEQKTGT
Download sequence
Identical sequences G3N7G7
ENSGACP00000001247 69293.ENSGACP00000001247 ENSGACP00000001247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]