SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001303 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001303
Domain Number 1 Region: 25-147
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-37
Family Phosphotyrosine-binding domain (PTB) 0.00092
Further Details:      
 
Domain Number 2 Region: 454-517
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000433
Family SH3-domain 0.00052
Further Details:      
 
Domain Number 3 Region: 544-602
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000903
Family SAM (sterile alpha motif) domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001303   Gene: ENSGACG00000001004   Transcript: ENSGACT00000001304
Sequence length 606
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:2875895:2881064:1 gene:ENSGACG00000001004 transcript:ENSGACT00000001304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRPSAKSIYLQRMEYAESVNKMMNTFQYRVEHLFTCDLDGKGLRSVADCVERLKLLDGM
GRVWGQNMQLEVRAANLLLTDIETKEELESMAFSDILDLQAVLDSGVFKSLLTVSVRPKG
KQTTTVFMFQCEEVRADYVQRDLLGALSRLIAGQQGMKNLHNAAKSNEPKERKLVVDSEP
HHNQQLSPLYFFHIEENYFLEPELVVPQRGEEEDEVPSPPQSINKEEPRSTSRPYTDLDR
NVDILNHVLSDIEIFMAKVTAIVAKNTKKKKKKKKGKGNLVQKTEFKVCLHKIKYGFNLV
GELNGTIDNPSAPDFVHSLFSTLSFLLSHCADDLPETIVAPLLTPQSIRLLSEEASAEED
KLWQSLGDAWNIPSTKWPEADEDIPTYTLEFSDGWQPPDVTAAPESYEPIRREEHQLLPS
GRHRAPLHKSHGTHEHVRFNPTSSECLPVFSFTPFLYFSSDESKLRSMLVTNDFISRNQR
ELTVRKGETVELLDKSKLWWKVRNSRGEEGFVPNNVLGAPEEMDTANATQHTGGAPVLTK
KSRPAEVKAWLEDKGFSKITVRCLGGLSGSMLLGMTREELKTVCPEEGGRVFFQLQAVKS
AVSDSH
Download sequence
Identical sequences G3N7M0
69293.ENSGACP00000001303 ENSGACP00000001303 ENSGACP00000001303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]