SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001318 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001318
Domain Number 1 Region: 621-817
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.65e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000229
Further Details:      
 
Domain Number 2 Region: 437-550
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 9-87
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000544
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 259-297
Classification Level Classification E-value
Superfamily WW domain 0.000000209
Family WW domain 0.0031
Further Details:      
 
Domain Number 5 Region: 366-395
Classification Level Classification E-value
Superfamily WW domain 0.0000167
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001318   Gene: ENSGACG00000001006   Transcript: ENSGACT00000001319
Sequence length 819
Comment pep:known_by_projection scaffold:BROADS1:scaffold_37:2177494:2216214:-1 gene:ENSGACG00000001006 transcript:ENSGACT00000001319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMADREGPPIAPGQIYIEVEFDYEYKAKDKMVAIRQGECYMLVKKTNEDWWQVRKDEGT
KAFYVPAQYVREVRRALMPPQKPTLRAKPTVLDICRVSNENLHRAHPEMSSFGRPSPSST
PSPSSDRFTPPAMSKDANQNVGSPHHCKMVAELVLLHNNNNHHHGNNSTLPRTRAESPPL
KVGNSHDTSPDSGKASPPCDLSGDRLNKLHNDSESGDELSSSSTEHMPTTSPTGQGRSDS
PVYTNLQELKLSQSSLPAVPSSSPLHILGDWETHKDLSGRHFYYNRASGERTWKPPRTRD
ASGSTSSARGDGQGTARGEPLSSEEFCHSTHSSQSDSQYGSPPRGWSEELDEHGHTLYVS
EYTQEKWIKHVDEQGRPYYYSSDGSRSEWELPKYNVSPQSGEVPKSRSLERKQQDPIVLT
KWRHSTYVLDLNDKPSEKCGVLNVTKITENGKKVRKNWTSSWTVLQGSSLLFAKGQGGST
SWFGGNQSKPEFTVDLRGGAVDWASKDKSSKKHVIELKTRQGTELLIQSEIDSVINDWYR
ALTETINTHAWESDEAIEEDMPESPGAEKQDKEKDHRDKKNRVMKTSVSMDSSDQKKTRL
KLKKFLTRRPTYQAVRDKGYIKDQVFGCSLTSLCQRETTSVPNFVTMCIDHVENTGLDVD
GLYRVSGNLAVIQKLRFAVNHDETVDLNDSKWEDIHVTTGALKMFFRELPEPLFTYGSFD
DFVDAIKCSDYKQRVNSIQDLIKKLPKPNHDTMQGLFKHLRRVIDHGEANRMTTQSVAIV
FGPTLLRPETETGNIAVHMVYQNQIVELILLEYDSIFGR
Download sequence
Identical sequences G3N7N5
ENSGACP00000001318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]