SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001353 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001353
Domain Number 1 Region: 128-344
Classification Level Classification E-value
Superfamily L domain-like 2.04e-26
Family Ngr ectodomain-like 0.031
Further Details:      
 
Domain Number 2 Region: 7-110
Classification Level Classification E-value
Superfamily Cap-Gly domain 3.67e-24
Family Cap-Gly domain 0.00082
Further Details:      
 
Domain Number 3 Region: 416-504
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.52e-16
Family Ubiquitin-related 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001353   Gene: ENSGACG00000001045   Transcript: ENSGACT00000001354
Sequence length 505
Comment pep:known_by_projection scaffold:BROADS1:scaffold_171:135484:139900:1 gene:ENSGACG00000001045 transcript:ENSGACT00000001354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPTDLLGRRVSCDGERASVLYVGPVPPTEGLWLGVEWDNPQRGKHDGAHGGVQYFTCRR
PGGGSMSARSKLWLGVYQIDAEEVTSNDISFGPKKVKWGKITERSSYESLPSALLGSCEV
NGPGADGEIRKTTPNVQVLDLSASLLSRWEDVSAIAQQLEHLESLTLMNNRLRLPADVSA
HRRSFRGLRVLALNGCELTWPQILQCAPMWPQLEELSVQDNDITELQRRPEGVLQSLRSL
NVSGNRLAQHTVPALAALLRLEYLNLSKTGLSDIRFDDAAPGGQTDMFPALTKLNLEHNN
ISEWCVVNELAKLPRLTHLLCHSNQLVSSDGNPKTANQLLIAKLGGLVSLNNCEIHHKER
RGAEIDYIKMFGGEWLEAGGGRRPSAQFVSQHPRYLSLIAKYGAPEEGELKKPEPFALKN
QLLKITFVFPDAADREPIEKKLLASMLVQKVKGLLYRLLKVPAADLKLTYTSPKKLGTEF
EIDSDLKTLQFYSIEDGDQVLVRWS
Download sequence
Identical sequences G3N7S0
ENSGACP00000001353 69293.ENSGACP00000001353 ENSGACP00000001353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]