SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001418 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001418
Domain Number 1 Region: 395-524,698-854
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-42
Family p120GAP domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily E set domains 0.000000728
Family Other IPT/TIG domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001418
Domain Number - Region: 73-112
Classification Level Classification E-value
Superfamily E set domains 0.000644
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number - Region: 547-641
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00184
Family Ubiquitin-related 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001418   Gene: ENSGACG00000001099   Transcript: ENSGACT00000001419
Sequence length 917
Comment pep:known_by_projection scaffold:BROADS1:scaffold_121:176522:184390:-1 gene:ENSGACG00000001099 transcript:ENSGACT00000001419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LITVQGENLDTGTRDDVSVAVGGVPCEIVAFGEQITCRTGRFRGTKVPSELLPVTVLYGK
NTTKEVGAAFQYLEDPKVTNFLPKDSFLCGGRRIMVVGSGFDLTQRASLKVVPLANEFSH
SASPVEFVQEALSKNETVLQFLSPTAGAGVDPQALRTFLHLDNEKVELKNFVYHPDPSFN
KLDKNVITETGVIIVTGARISPKAMTAKRGAGLRGRPSCPVTSCRDDKLILDAPQSQPGS
RRQRRDTADNMLELVVKFGHGEWTVDSVSYARKDDIPLATIIPSVIIPMLLFIAVSVYCY
RRRKSQQAEREYGKVKNQLANLEESVRDRCKKEFTDLMIEMEDHTSELSEARIPFLDYKT
YTDRNFFLPSKDGANDAMITGKIQIPEARKAIVAQALNQFSNLLNSKTFLINFIRTLESR
PDFNARSRGYFASLLTVALHGKLEYYTDIMRTLLLELMDEHVQNKNPKLMLRSRSETVVE
RMLCNWMSICIYQFLRDTAGEPLYKLFRALKHQVEKGPVDAMLKKAKYTLNDTGLLGDDV
EYSVLTLQVLVHGEGPDVTPVKVLNCDTITQVKEKIIDQVYRNLPYSQRPVVESVALEWR
PGSTGQILSDMDLTSQQEGRWKRLNTLAHYNVRDNATLVLSRVLHTRSFHQHQDSYEENA
LLEEDNTYHLVRPADEMDYGKSKRGSMKDKAMTKAITEIYLTRLLSVKGTLQQFVDDFFR
SVLCSSTVVPPAVKYFFDFLDEQAERHDNVDEETLHIWKTNSLPLRFWVTILRNPHYVFD
VHVTEVVDASLHVISQTFMDACTKTEHKLSRESPSNKLLYAREISTYKKMVDDYYKGIRQ
MVPVSDQDMNTHLAEVSRQHTDKLNTQLALHQLYQYASKYYDVIIQSLDEDPAAQNKQLT
LRLQQIAAALENKVTDL
Download sequence
Identical sequences G3N7Y4
69293.ENSGACP00000001418 ENSGACP00000001418 ENSGACP00000001418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]