SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001494 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001494
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily PH domain-like 7.25e-56
Family Necap1 N-terminal domain-like 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001494   Gene: ENSGACG00000001151   Transcript: ENSGACT00000001495
Sequence length 259
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:3223975:3227612:-1 gene:ENSGACG00000001151 transcript:ENSGACT00000001495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDNSYESMLCVKPEVHVYRIPPRASNRGYRAADWKLDEPAWSGRMKITAKGKLAYIKL
EDKNTGELFAQAPVEQYPGCVVESVTDSSRYFVIRIEDGNDKGRHAFIGLGFADRGDSFD
FNVALQDHFKWVKQEGELAKQEASESTAPKLDLRFKEGQTIKISIGQNIKKKEAGGAKSR
PMAMGLLPPPPAGKVGGVIPPTVGQPTVSAVQTTTDPASLLDFGSPGPSAPPSADVWGDF
TSAGSNSSKDAVQSGWVQF
Download sequence
Identical sequences G3N860
69293.ENSGACP00000001494 ENSGACP00000001494 ENSGACP00000001494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]