SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001499 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001499
Domain Number 1 Region: 23-77
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000377
Family PHD domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001499   Gene: ENSGACG00000001153   Transcript: ENSGACT00000001500
Sequence length 573
Comment pep:known_by_projection scaffold:BROADS1:scaffold_237:53328:62013:-1 gene:ENSGACG00000001153 transcript:ENSGACT00000001500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLVSSQSEEAAGLEGIFMKIPKGPLYCVCRKPEINCFMIGCDCCTEWFHGRCVGVSEKA
AKSIRVWFCPLCRGQTKDASLEIKYRLKKTMEEKELETGDGRSTPNARIDNRRGSQIKRS
ARMCGECDACLRTEDCALCDFCKDMKKFGGPNKIRQKCRQRQCEVRARKMLRVKEEEMSR
SCVRGRGLTRKEAGHQTEEDEEDEDEENHYQIERLSEVWHSEEEDAQSDSLRKKAVKVKH
VRRPEKKTEKKKEEAKPRRHKAKQRHKERVRHSERGGEGGTKEVGVAMRQCLGPGCVVPT
RTNSKYCSDDCGMKLAANRIYEILPQRIQQWQQSPCVAEEMGRRQLERIRKEQQASRLRL
TMMEKRFHELEGIIANAKQQQVQQHEEVTEGDGEDTDHQVFCVSCSHPVNPKVALRHMER
CYAKYESQTSFGSMYPTRIEGATRLFCDVYNLQSQTYCKRLQVLCPEHSRDPKVPADEVC
GCPLVRDVFQPTGDFCRLSKRKCNKHYCWEKLRRAEVDLERVRVWYKLDELFEQERNLRT
AMTNRAGLLALMLHQTIQHDPITTDLRSAQKKR
Download sequence
Identical sequences G3N865
ENSGACP00000001499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]