SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001522 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001522
Domain Number 1 Region: 696-752
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000031
Family PHD domain 0.0037
Further Details:      
 
Domain Number 2 Region: 645-703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000975
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001522   Gene: ENSGACG00000001172   Transcript: ENSGACT00000001523
Sequence length 767
Comment pep:novel scaffold:BROADS1:scaffold_146:208612:217838:1 gene:ENSGACG00000001172 transcript:ENSGACT00000001523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REPSPSEPTELLQSREPSPSEPTELLQSREPSPSEPTELLQSREPSPSEPTELLQSREPS
PSEPTELQQSPAPSPSEPTELQQSPAPSSSAPFNKDPAELQQSPAAPPSEPTELQQSPAP
PPSEPTELQQSPAAPPSEPTELQQSPAAPPSEPTELQQSPAAPPSEPTELQQSPAAPTSE
PTELQQSPAAPPSEPTELQQSPAAPPSEPTELEQSPAPPPSEPTELEQSPAASSSAPSNI
DPTELQQCLAPSPSEPTELLQSPAASTSEPTELQHSPAPSTPEPTEAPAESYPHPPSAPF
HLEPPEAIPSPVPGCPSRCEASPHLVSPVLSTHEQSDTSPSSGLATHVLSETIPWPGLTG
HEQSVTSPSPCLATDESETSPTPGLTILERNKTSPGLTGPEQSETSPCLTRFKEPEPCSS
SGLTGPEVSQTSPIPGLNCAEQSEPAAHITPHTTTHSAVPVQQPSSSPASSRPASPFPSP
QSPPPRAGSPEAPLHKIALLPTCSPPTLPSPSLPLEEEPTYQSNALTGEMGLEDKQVLCH
VTSANNDGQLQSRIQLAKDKHQSHAEPLEDRLNEGRGSGFPGRRRSRGGLGGARGARGRS
RLKTQESLTVSPGVNIKDCCVRVSVCMWSRSSNSMHNTVVMFSTSDLFTLRQDMCVVCGS
FGRGAEGRLLACSQCGQCYHPYCVSVKVTRVVLTKGWRCLECTVCEACGEASDPGRLLLC
DDCDISYHTYCLDPPLLTVPKGAWKCKWWVTRCVWCVKCGSASPGLQ
Download sequence
Identical sequences G3N888
69293.ENSGACP00000001522 ENSGACP00000001522 ENSGACP00000001522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]