SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001555 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001555
Domain Number 1 Region: 703-1063
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.53e-86
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000006
Further Details:      
 
Domain Number 2 Region: 523-700
Classification Level Classification E-value
Superfamily ARM repeat 2.81e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000275
Further Details:      
 
Domain Number 3 Region: 109-300
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-49
Family Ras-binding domain, RBD 0.00056
Further Details:      
 
Domain Number 4 Region: 337-477
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.51e-42
Family PLC-like (P variant) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001555   Gene: ENSGACG00000001192   Transcript: ENSGACT00000001556
Sequence length 1071
Comment pep:novel scaffold:BROADS1:scaffold_129:231307:246036:-1 gene:ENSGACG00000001192 transcript:ENSGACT00000001556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRPSSGELWGLHLMPPRILVDCCLPNGMMVSLECLRETPLISIKQQLFTEARKYPLYH
LLQNGQEESSYIFVGVTQEAEREEFYDETRRLCDLRLFHPILKVIEPLGNREEKILNREI
GFAIGMPVCEFEMMKDPEVQDFRRSILSVCREAMEEREGGGAHSQALYVYPPNLESSPQL
PQHIYSKLDKGRLIVTIWVIVSPSNSKQKYTLKVSHDSLPEQLIAESIRKKSRSMHLSPQ
QLRLCVQEYQGQYILKVCGCDEYLLEKYPLSQYKYIRSCIIVGRLPHLMLVSKDSLYSQL
PASGFVTPSYSRRTPQPSPCPGGGDGSPPRSLWAFNTLLRVRLLCATYVNVNIRDIDKIY
VRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLAYDIYLADIPRSARLCLSICSVKGRKGA
KEEHCPLAWGNVNMFDYTDILVSGKVALSLWPVPHGLEDLLNPIGVAGSNPNKETPCVEL
EFSWFNQTVVFPDEQQIEEHANWTISRELGYNYCHGVSSRLACDSRTSVADTEQLCSLCS
RDPLYELSEQEKDFLWRHRHYCVNMPESLPKLLLSVKWNSRDEVSQMYCLLKEWPLMEPE
SALELLDCNFPDPMVREFALRCLVQGLTDDKLSQYLLQLVQVLKYEMYLDNPLARFLIKK
ALTNQRIGHFFFWHLKSEMHNKTVSRRFGLLLEAFCRACGMYLKHLNRQVEAMDKLVNLT
DTLKQEKKDETQKTQMKFLVEHMSRPDYMEALQGFVSPLNPVHQLGNLRLEECRIMSSAK
RPLWLNWENPDIMSELLFTNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPY
GCLSIGDCVGLIEVVKNSFTIMQIQCKGGLKGALQFNSNTLHHWIKDKNRGEAYDRAIDL
FTRSCAGYCVATFILGIGDRHNSNIMVKENGQLFHIDFGHFLDHKKKKFGYKRERVPFVL
TQDFLIVISKGVQESTKTKEFERFQEMCYKAYLAIRQHASLFINLFSLLLGCGMPELQSF
DDIAYLRKTLALEKSQQEALEYFTKQMNDAHHGGWSTKMDWIFHTIRHMPN
Download sequence
Identical sequences G3N8C1
ENSGACP00000001555 ENSGACP00000001555 69293.ENSGACP00000001555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]