SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001589 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001589
Domain Number 1 Region: 288-455
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.96e-75
Family Mammalian PLC 0.00000778
Further Details:      
 
Domain Number 2 Region: 132-286
Classification Level Classification E-value
Superfamily EF-hand 3.67e-39
Family EF-hand modules in multidomain proteins 0.013
Further Details:      
 
Domain Number 3 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-27
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001589   Gene: ENSGACG00000001222   Transcript: ENSGACT00000001590
Sequence length 495
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:3523389:3526548:1 gene:ENSGACG00000001222 transcript:ENSGACT00000001590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERCMCTMQTGTQMTKMKGKKKGLVRFFYLDEHKSCIRWRPSRKHDKAKITIDSIHEVCE
GKRSEIFRRYADNRFDPNYCFSIYYGERVKSLDLVSTNAEEARTWITGLTYLMAGISDED
SLARRQRTRDQYLTWLQQTFSEADKNGDGTLSIGEVHQLLHKLNVNLPKQKVREMFQEAD
TDDNQGSLAFEEFCLFYKMISTRRDLYLIMISYSNQKEVMDLHDIARFLENEQKMRGLAK
EYLIDIVARFEPCPENLQRTVLGIDGFTNYMRSPAGDIFNPEHNRVNQDMTQPLTNYFIA
TSHNTYLTGDQLLSQSRVEMYAYVLQAGCRCVEVDCWDGPDGEPIIHHGYTLTSKILFKD
VIETINKYAFTKSPYPVILSIENHCSVPQQKKMAEYLREVLQDKLDLSSVNVHESKKLPS
PEILKGKVLVKGKKLPANLDPDAEEGDVSDEDTGDEEEEEGEDDNDDSQANRKKRIRVRS
KTLSDGESDQSSIKE
Download sequence
Identical sequences G3N8F4
69293.ENSGACP00000001589 ENSGACP00000001589 ENSGACP00000001589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]