SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001677 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001677
Domain Number 1 Region: 136-217
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000227
Family Ras-binding domain, RBD 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001677
Domain Number - Region: 228-258
Classification Level Classification E-value
Superfamily Ferritin-like 0.014
Family half-ferritin 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001677   Gene: ENSGACG00000001286   Transcript: ENSGACT00000001678
Sequence length 271
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:3593010:3596564:1 gene:ENSGACG00000001286 transcript:ENSGACT00000001678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHAAGGSEKSASFERTWGSSASSGYCSDEESDSEFEQYFTARTSFFPKTRADAGNVGAR
VKQELTTADIQQKVKEYNAQINSNLFMNMNKDGSFTGFIKVQFKLARPVSVPPPKKGGQD
AGGRKAAGVKRRTSFYLPKDASKHLHISSRTSAREVIEVLLKKFTVVDNPGKFALFERSE
RHDQVYVRKVSDNESPLRLRLCTGPNEKVLSFVLKENETGEVNWHAFSMPELKNFLRILQ
REEEEHVKQIVQRYAQARTKMREAVAGSTPG
Download sequence
Identical sequences G3N8P1
ENSGACP00000001677 ENSGACP00000001677 69293.ENSGACP00000001677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]