SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001742 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001742
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Sec7 domain 6.93e-37
Family Sec7 domain 0.00022
Further Details:      
 
Domain Number 2 Region: 177-311
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-26
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001742   Gene: ENSGACG00000001338   Transcript: ENSGACT00000001743
Sequence length 411
Comment pep:known_by_projection scaffold:BROADS1:scaffold_156:116792:127428:-1 gene:ENSGACG00000001338 transcript:ENSGACT00000001743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNEFSQMVAEEYLSNFSFRGLTIDQALRTFLNRFALMGETQERERVLAQFSRRYRQCNPQ
GVPSEACIHHTTCDVSRLNTSGVQNKNVGKRMSCNQFITNLEGLNDGRDFPKDLLKTLYS
SIKNEKLQWTIDEEELKKSMSELADVRTDSASHTMKRLGGGGNLLVGVAQQADGELYKSG
FLIRKVHADADGRRTARGKRGWKSFYAMLKGLVLYLQKDEFRAECELTEEDVKNAVSIHH
SLALRAADYSKRPNVFYLRTADWRVFLLQAPNAEQMQSWITRINVVAAMFSAPPFPAAIG
SQKRFSRPLLPGSNTKLSQEEQVKCHENRFRAVSSELADLTASTPDRKVKGRELEEQKLR
QEYLDFEKTRYGTYAMLLRAKLSSGDEDLAAFESRLFEDGGLQRTHSSPTL
Download sequence
Identical sequences G3N8V5
ENSGACP00000001742 69293.ENSGACP00000001742 ENSGACP00000001742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]