SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001798 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001798
Domain Number 1 Region: 482-604
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-23
Family Pleckstrin-homology domain (PH domain) 0.000000849
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001798
Domain Number - Region: 365-465
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00392
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001798   Gene: ENSGACG00000001382   Transcript: ENSGACT00000001800
Sequence length 1333
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:4081612:4132724:-1 gene:ENSGACG00000001382 transcript:ENSGACT00000001800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPSSSEEESDGIVEEESKEAMAPQAGSRISPTRTSESSGGLAPGSGGSRGSARPTSPS
PSAASEEKEDLEKMHREEEDRKKKLQLYVFVMRCVAYPFNAKQPTDMARRQQKITKQQLQ
QTKDRFQAFLNGDTQIVADEAFINAVQSFNEVFLKSDRVAKMVQSGGFSANDFREVFKRH
IEKRVRSLPEIDGLSKETVLSSWMAKFDTIYRGDEDPRKAQQRMTASAASELILSKDQLY
EMFQNILGIKKFEHQLLYQACQLDNLDEQAAQIRRELDGRLQMADQIARGGKFPKFVSKE
MEAMFIEELKSSVNQLMANLESMPVSKGGEFKLQKLKRGHNTSIIDMGQEDENTLSKSDV
VLSFTLEVVIMEVVGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTWGTQGDFTTTHP
LPGVKVKLFTESTGVLALEDKELGRVVLHPTPNSPKQSELHKMTVTKACPDQDLRIKLAI
RMDKPQNMKHCGYLWAFGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKSEPQELLQLDG
YTVDYSDPQPGLDGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQ
VQKLNSKGGASAQMDAPISQFYADRAQKHGMDEFISANPCSFDHASLFEMVQRLTLDHRL
NDTFCCLGWFSPGQVFVLDEYCARNGVRGCHRHLCYLRDLLERAESGAIIDPTLLHYSFA
FCASHVHGNRPDGLSTVKVDEKERFEDIKERLRVILENQIVNFRYCFPFGRPEGALKATL
SLLERVLMKDIATPVPPEEVKGVIRKCLEQAAQLNYERIKEYAAIEVEKGQKDQKDPENV
GRLVTPAKKLEETIRLAELVIEVLQQNQEHHAEESSNWCSTDHGHAFAWWTDLMVEHAEN
FLALYAVDMDAALEIQSPESWDSFPLFQLLNDFLRNDYHLCNGKFHKHLQDLYAPLVVRY
VDLMESSIAQSIHKGFERESWEPVKSLTSNLPNVNLPNVNLQIPKVPNLPVPVAGLSVNL
PQMPSFSTPSWMAAIYDSDNGSGTSEDLFWKLEALQTFIRDLHWPEEEFAKHLESRIQLM
SSNMIENCVKRTRIAFESKLTKSSKSTDFRISPTLCTMFNVMVDAKDQSAKLCAMEMGQE
KQYHTQIDELIEESVKDMIQFLVAKFVVILESVLAKISRYDEGTLFSSFLSFTVKAASKY
VDVPKPGMDVADGYVTFVRHSQDILRDKVNEEVYIERLFDQWYTATMNLLGTWLTERMEQ
QLHVYQLKILIRITKKKYRDFRLQGVLDSTLNSKMYDTVRNRLTIEEATASVREGGMQGI
SMKDSDEEDEDDD
Download sequence
Identical sequences G3N910
ENSGACP00000001798 69293.ENSGACP00000001798 ENSGACP00000001798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]