SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001820 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001820
Domain Number 1 Region: 623-770,818-971
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-80
Family Protein kinases, catalytic subunit 0.0000024
Further Details:      
 
Domain Number 2 Region: 86-126
Classification Level Classification E-value
Superfamily UBA-like 8.93e-17
Family UBA domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001820   Gene: ENSGACG00000001402   Transcript: ENSGACT00000001822
Sequence length 1014
Comment pep:known_by_projection scaffold:BROADS1:scaffold_115:270348:279871:-1 gene:ENSGACG00000001402 transcript:ENSGACT00000001822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKTFPAAPYMGNTRQRLQEIKEGLKQPAKLVSQALQGAGSRGADCKTGKDAASRQQQQ
LRPPQKFNNHQNALLEIRKSLKPYEVNRQMLQDLVNAGCDQEMAVRALKQTGSRNIEAAL
DYISKMSYLDPRNELIVRVIKQTSPGKAAMPNPMDHRPPLEAPGEVGAMPQYHQMGAPLY
EGAGGYGPKGELPRPYMSAPPVMNYMIPPSEQHGPMMSYTVPGQPLQLQPQPQGGPVPGP
HYDYGHARPHMMEPAGYGVKRTASFQSKMAPSMVQSVPAGGGYPANLYLPPHSHPRQASP
TSHHVHIMSRGAGPEFSDMPQGLMTPSRASLNLDLYEHHWAGPPGVDGAPQARQPQGPFR
GEVRAPSRTNSFNSRSVGPAGVRPAMTAPPAVGKQDPSLGQPNTITAVTSPPIQQPVKSI
RVMRPEPKTAVGPCHPSWMTAQDAAESLAYMPEETYSLEPPQEPRCPPPPYPKNLLMEEG
AAAICAAQDGGGSSRSSPGSGKADESQQVKEKTKTGKGEKAVKDKKQIQTSPVPVRKNGR
DEEKRESRIKTYSPFAFKFYMEQHIENVMKTHQQKLNRRLQLEQEMSKAGLSEAEQKQMR
KMLNQKESNYNRLRRAKMDKSMFVKIKTLGIGAFGEVCLTRKVDTGALYAMKTLRKKDVL
NRNQVAHVKAERDILAEADNEWVVRLYYSFQDRDSLYFVMDYIPGGDMMSLLIRMGVFPE
HLARFYVAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYY
QKGSHVRQDSMEPSDFWDDVSNCRCGDRVTMEQSANRQHQRCLAHSLVGTPNYIAPEVLL
RKGYTQLCDWWSVGVILFEMLVGQPPFLASTPTETQIKVINWESTLQVPAQVKLSPEAVD
IIGHLCCSAEDRLGANGAGEIKAHPFLAQMDFSSNPRQQPAPYRPKIAHPMDTSNFDPVE
EEGGPGASSDSGDSTRALDALCLPHGKHPEHAFYEFTFRRFFDDNGCPFRYPKP
Download sequence
Identical sequences G3N932
ENSGACP00000001820 69293.ENSGACP00000001820 ENSGACP00000001820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]