SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001866 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001866
Domain Number 1 Region: 334-478
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-39
Family Third domain of FERM 0.00000642
Further Details:      
 
Domain Number 2 Region: 230-335
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-31
Family Second domain of FERM 0.00000324
Further Details:      
 
Domain Number 3 Region: 149-229
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-23
Family First domain of FERM 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001866   Gene: ENSGACG00000001433   Transcript: ENSGACT00000001868
Sequence length 778
Comment pep:known_by_projection scaffold:BROADS1:scaffold_111:49534:79807:1 gene:ENSGACG00000001433 transcript:ENSGACT00000001868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEQLRTRNRNSAGRGLSRLFSSFLKRRSQCESDAGEKDGKEEEAKAPIADPEPELRIEGE
VAPDQHSVSSAEAQEEEAGNDKEAKEGGEEAAPEKEDKEKEEDDEEEEEKEGSPEGGRHR
EKEEEEEEEEKMAEEETKAPRAPRRPKTMQIRVTLLDDALYECELDKHAKGQELFMKVCD
HLNLLEKDYYGLVTSELATMKTWMDLTKEIRRQVQGTNYNFTFNVKFYPPDPAQLSEDIT
RYYLCLQLRKDILQGRLPCSFVTLSLLGSYALQSELGEYDPEVHGTEYAKDMKMAQGQTK
ELEDKMMELHRTYRSMSPAQADLMFLENAKKLSMYGVDLHQAKDLDGVDIMLGVCSNGLM
VYKDKLRINRFPWPKVLKVSYKRSSFFIKIRPSEVEHYESAIGFKLPNYKAAKKLWKVCV
EHHTFFRLTSTEMATTPRKFLALGSKFRYSGRTQAQTRQASSLIDRPAPLFQRSSSKRNS
RSLDGAMASTPDNKSSRPVSAPIMSPVSPGEAAPSPLLPTLTRSDHHRSTHRGHRSANRK
AEAQPAEDTKSHSPRPESTPQMKVKRAKKLEGETIYIRHSNLMLEDLDKTQTGIMRHHTS
ISELKRSFMESVPEPRPSEWDKRLSTNSPFRTASINGLLQPSSPVLKTQTITVSDNTNSL
RGSVTYKDIPLVHTETKTITYESAEPVDGLAERDTGVLLSAQTITSETISTTTTTQITKT
VKGGVSETRIEKRIVITGDTEIDHDKALAQAIKEAKEQHPDMSVTKVVVHQETEISPE
Download sequence
Identical sequences G3N977
ENSGACP00000001863 ENSGACP00000001866 69293.ENSGACP00000001866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]