SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001903 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001903
Domain Number 1 Region: 68-117
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000000136
Family Transcriptional factor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001903
Domain Number - Region: 8-35
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001903   Gene: ENSGACG00000001469   Transcript: ENSGACT00000001906
Sequence length 118
Comment pep:known_by_projection scaffold:BROADS1:scaffold_111:199525:200337:1 gene:ENSGACG00000001469 transcript:ENSGACT00000001906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYFSDDPNFCSQCGNVLPLPGIQDVVRCPRCSFCIPGTEFSGREIRSTVVLNPEEQSSM
ALKDEEDAELKGPVIDRRCARCNKEGMVYHTRQMRSADEGQTVFFTCIHCRYQDKEDS
Download sequence
Identical sequences G3N9B3
69293.ENSGACP00000001903 ENSGACP00000001903 ENSGACP00000001903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]