SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001953 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001953
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-38
Family Phosphotyrosine-binding domain (PTB) 0.00000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001953   Gene: ENSGACG00000001501   Transcript: ENSGACT00000001956
Sequence length 532
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:4301585:4306711:1 gene:ENSGACG00000001501 transcript:ENSGACT00000001956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCWSCLYRDPIRDNHLTKFKVTNVDDEGNELGSGIMELTQTELILHTRKRDAIRWPYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNLLQELMQCNSINVVEESMMMS
RSGHTPEMEMSRTPQTPNKLGTTAFPNGYPGYPIRGDSSQPSLADDHGHTLMALEDQTHT
YVNTVSMEGDLSMRHCVHSLPEVRPGSFPETTRGAMPVGGQGNPPSNLRCCPLEERNDPQ
VFLQPSSQEVKFMLGPTPAQRHLLERDNSHSYHHFHHHAHRHPGLEHSDSCQSGELTYEN
INGLRSGRKQRLSPSSVSQSLGSSSSSSTGDSHTHHRRTALLNYENLPSLPPVWEYSALQ
RDDEYEFSEGPGTPNGYHQDGRGIHRDALQNYVNTEQVQPPRLRHACPPHPRPCQPDRGG
GVFSFDFRRRSRSGVGGCEHGHMPPSRQLNYIQVDLEGEPPCQGLNSGGAQTQPQHQRLP
PKKCGPQAPRRSECYAVIDLKKTAAMSNLQKALPRDDGTSRKTRHNSTDLPL
Download sequence
Identical sequences G3N9G3
69293.ENSGACP00000001953 ENSGACP00000001953 ENSGACP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]