SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001992 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001992
Domain Number 1 Region: 239-373
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-26
Family UBX domain 0.011
Further Details:      
 
Domain Number 2 Region: 3-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000153
Family Thioltransferase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001992   Gene: ENSGACG00000001530   Transcript: ENSGACT00000001995
Sequence length 488
Comment pep:known_by_projection group:BROADS1:groupXVI:448368:456028:1 gene:ENSGACG00000001530 transcript:ENSGACT00000001995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWFEGSIPDAINLAKQRSCVFVVVITGTDDLSGQLIASWEDDKVSEEAKNCCVTIRVDA
KSEPCVQFSQIYPVVCVPSSFFIGENGIPLEVIAGCVSAEELMKRINRVKQMHAQQFGCD
AVLPAASGPVETTPLNSTTPVPAPASLSSTADDGRLAAPMAPAENAAQSEGHLEARVERR
LSKRHFSKRKMLTKAYCLQKQKEIQVEVERRKMGKDVQDLKKKQEEERTKRLLEERNKEK
AEEKAARERVRQQIALDRADRAARYARTQEEERTAKQAVLQARQAQKEAVVRERSTIARI
QFRLPDGSAFTNQFPSQSRLQEARNFAVQEVGNRYGNFSLATMFPRREFTSEDLDKTLLE
LELAPSASIVLLPQSSRPANTVMQSSDGGLWAVLGTLLYPLLAVWRFLSAFLFASPPPAG
AESRGHGQPSGSYANAASDKAKRETDSKQPEEKRPKGFTKDGKVCRLRTQEDSEDENNTW
NGNSTQQM
Download sequence
Identical sequences G3N9K2
ENSGACP00000001992 69293.ENSGACP00000001992 ENSGACP00000001992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]