SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002037 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002037
Domain Number 1 Region: 13-65
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.67e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0029
Further Details:      
 
Domain Number 2 Region: 172-252
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000189
Family Ras-binding domain, RBD 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002037   Gene: ENSGACG00000001555   Transcript: ENSGACT00000002040
Sequence length 307
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:4485274:4490422:-1 gene:ENSGACG00000001555 transcript:ENSGACT00000002040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPRRQAGAAGAGHDFQPYSYTHLTWCDLCGEFIWGVYKQSLRCANCSYTCHYRCRPFI
QLDCRTHGSLLTEEDDFSVDSLETDTNVDEQIDWGKQKLTVCEIQHKVKEYNAQINSNLY
MMVNKDGSYTGFIKVHFQLVRPVSLPPSQSLCSSQEDDQQGRPMKRRTSFYLPKDTAKHL
HISSQTRVREVIEALLNKFTVVDNPAKFALFERAERQSQVYMRKLPDDEFPLYLRLCAGP
SEKVFSLVLKENETGEINWDAFSLPELCNFLRILKREEEEHVRQIVKRYSLARDTTKQAL
ARISTPS
Download sequence
Identical sequences G3N9P6
ENSGACP00000002037 69293.ENSGACP00000002037 ENSGACP00000002037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]