SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002045 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002045
Domain Number 1 Region: 282-366
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000106
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.025
Further Details:      
 
Domain Number 2 Region: 56-122
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000161
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002045   Gene: ENSGACG00000001561   Transcript: ENSGACT00000002048
Sequence length 3517
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:4520285:4562480:1 gene:ENSGACG00000001561 transcript:ENSGACT00000002048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETRQHAAPQAEQGHVSRKSLHVDVGSSRTGRSPSVSPDRGSVPSSPYSVPQIAPMPSSKL
CPVCKTTDLMGTGDDKPTFNTCTQCCSMVCTQCGFNPNPHLTEVQEWLCLNCQMQRALGM
DMTTPRSKSQQQIHSPSHGQAHPPGQAHSSPGFVKQAGPAGPGQQQIKLPPGAVALPGMA
KAPSQPDLSRNSPAHQPQPPRHDQTRSAGSSPSRQPPPPEQTFGKLFGFGASLLNQASTL
ISETTQPQQQPPKTAPKPVGPVGPGPGAGKASGAPPAQQGPRAHAQQQQQNAPMDSTKPK
ACCPLCKTDLNIGNTAEQPNYNTCTQCHHQVCNMCGFNPTPHLVEKKEWLCLNCQTQRAL
SGSLGDAAAPVAQPLGSPRPPATANQQPPQQKGPNQLLGPRPTGPQQQQKPPGPQPGKAT
PNHAKASPTPSKTTPAQSKPTGNNQGRKQPQEKAKVASKTVKEDVKASPKKILSETITST
KDMKIAEDTQNIKPAMVTIIKTSSFTMSGCPIEDLFSQISLFPQDYNKSSTSLSDTGYSS
DGISSCHGEITGQIREEGIQLSEKGASIPSEITKLESSMKPLLESKTSDQKHRPHSLSVG
QGRDYNPDDEAARDESEDELSCKLRHDYVEDSSESGLSPLPVRQKKSHKDLTDEEFMRRQ
ILEMSADEEEMEEHGNQKSKRVHKTGGDLSKERRRLAHQSNSFEEDTKPTEANEEEDVVM
AGGLRRFKTIELNNTNSYNRDMELSTEHDLREPELEMESLTGSPEERSKGDYSSTLPATT
PSYTSGTSPTSVSSMEDDSDSSPSRRARLEEAKQQRKARHRSHGPLLPTIEDSSEEDELR
EEEELLREQEQMRDLEQQRIRSTARKTKRDKEELRAQRRRERSKTPPSNLSPIEDASPTE
ELRQAAEMEELHRSSCSEYSPSMDSEAEGFEMIGGKLYKSGNEYNLPTFTSLYSPTEKTS
LISPSDKTLKSAEEVYEEMMKKAQLMQRQKGTSQPDSKHHLEAAGTVLTPGSSPTQVTAP
MSFPTTGSDPRIPGMHAAQHLSKETQNRMMTQSAKIEGVVGVATTKAQVSQTATTRQAGS
TVPGGNRGGSHRPTQASPDSAASSLTSKVFSLFKGPSPPVSPNASPAQSPTHMSSVRSTG
GSGRQLPSLPGGPTSATASHGAQAPQRATSPRLARQQSSRDSPAMVITLASDTTSPAKPL
TVNSSTSPLSSPTQVSCKTLYSTQPSSTSSPTSPQMHPSQQSPKHSSQIGLWENISLCKS
SSMGCGVKVQTHQISNVVDLRAPVRPAPIIMTDQGMDLTSLASDARRYSLGAEQPSGRHT
AVQPLIMNLNAQEQPYISVSTPTTVSVTVAGSMFMSQPKHQVVYGDPLQHRVDLGQGVGS
AVCLSQNKPPITDPSIPKIDACLENLGKSSFARYNLANQVQPTLMKKDLVVSQTSSGQPA
VTASAIPRVSPLVPPPVSGAPASNTPLEVYSGVALELKNKPTVMNLSTGKPHVMMVQLDE
NKPSHGGTVTQLVKEEPPLPPQVLDLTGQIKPENQVACCDVVYKLPFAGSCSGSFNQKPP
TISSDKTPTPESSQAAYPPHPPHYNIIQQQQKQHQPQPTQRVTEEHKPYLPPVGSSGRIQ
PSMSDSNLPSVTDAGHYQTNIQGGLAVDLSSMNQAYDGGYLGIGAQYGSYTDLRQQADIT
GPSLPLRRYGSMSNINSDYVYNSRDQTGSQDSNLAQYSATTAREISRMCAALNSGDQFGS
RYGNIPELLPYGAGRAGSLGRLNLQQSLATIRANLLYGPDGRPTANGQTLTNLINARQAS
IRALYPAAMRGGDGMIYSTINTPIASTLPITTQPSSVLHPVPRGIYRPYPTGVTAVPLAS
LTRLPQVTPRMPLSTQGPYSYPTPNQYPTSATPSGSVPEASSSHQETPVYLGRPITTVSA
QTVATIPPTQHAAQLGAQNTQTQPQIQPISQPQPLALPQGQPQGTVHGAALPPSSAISPP
VDAMKSKDDERLSQQQEHVLNLERERVELEKLRQLRLHEELERDRVELQRHREKEQLIVQ
REIQELQTIKQVLHQQQTERETQLIMQREQLAQQRMQLEQQSLQHQLQQQLEEQKRQTTA
QGAKQGVVVGTAPPQGFIICDQSGRVIQQDGQSVQFWQDGQVVQAMVAARPIHSSASMSL
RSSDKQTDSKMMKKQNSMPRLRDGTEDDSLRKITDSCVQTDDEDGEDRFMNRRRRTRRIA
DSSVQTDEEDQGEWEQQPVRRRRSRVSKHSESSGEAKSEGSSKVASASIAIQTTNDSSCQ
TEPDQLSRNSPAIHITMAETSKVDLLHYIAAPERTNKGESLACQTEPESQFHGVVAPQLS
VPTTINPYSTSLHIVGANASEPTSPRHQGVVKFERRKPDPLEIGYQQNESPSRQPPKSPQ
VLYSPVSPLSPHRMLETTFASQEKLNKAHVTPQQKAFTTESPQRHQTLPRPIKSVQRSMS
DPKPLSPTSEDPAKNRFSPYHQQAVSNSQMASLQQQQNALMRKIKRTLPSPPPEETSLPI
VTPAQMYSSPGMPQRVLPRPAQGVTKAGLLSELKAVEQESSKLRKQQAELEEEEKEIDAK
LRYLELGITQRKETMVKDRERRELAYMRCMGDARDYMSDSELNNLRMYPSTSSYMSYPYP
QVQPSTQQPGSAYQQIGFQPPQYPSSSAPQPGTFQPHPPPGPGYQNQGTYSNRMYAQPSY
QTDLGMQQHGNQGFHPSGQPMPSQNLPYPSHSSYQPALSYQPQADILTVHQRPRQTSLAD
LEQKLPTNYEVISNPAVSVATSVPDSNFGSVYSNAYGQYRPPEHGLPHSVESPPSAYSSD
GVYASNLEQNIPRNYVMIDDISELTKDNASQSTDAQGHPVGGRYRNENGPARGSAYSRPE
DEPVDGYGRPSGTTGYQNTVDSRPSTTVSGGSSYYYDDYKHPSRSGSSSHKLAPKNLAPA
VVSSKRSKHRKQGMEQKISKFSPIEEARDVESDLASYTMTTSTGGSCTVVSRSKKLQDDA
TYGIKKNTYDQQKYYGTSRDGLEEEDRMYSSGRSRSTGYGMDKISSRDATGHRSKSYERD
AMERSQRSSRSGRPPMRSQNSEEESPISPVGKPVGMGGGSGIPEAHDVRNQYGSSHSLPD
VQDHHKKDQPRSQVYKPDDPYLVDDMHCAVSDSEVSKAYHLGQEETDWFEKPREARSDRS
RHHGVHSSTGRRSKHTYHDYDEPPEEYCPQDEYNQQQRHPSSTTPRDHRPHGGSSGRHSS
SRHTSEDPRSTRSSRTHPKDPSVRSDGRGSSSTQRRNGPDSRSAQGSPRNSGDFSRDPAS
GHHHGTAGRSQRPQGDRTTPRRQEPSTAGPKAPSHGHAGQQRSGGPGQSGRHPGSEPLDV
TQQAQQQHPQSAPPPLPHSQTPQSSQPTSTTAGAGPAQPQPKSGQAPLGRQPGVGSVAGQ
PATTAKMEAIPGMKPTTGVPTATQPTKIATPPLVGIGSKAPVGIGSKPVAIGSAAAGQPP
AEGENVLTKILQGGAAEQAGKLGDALSGFGKKFTSLW
Download sequence
Identical sequences G3N9Q4
69293.ENSGACP00000002045 ENSGACP00000002045 ENSGACP00000002045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]