SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002177 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002177
Domain Number 1 Region: 118-171
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000777
Family Myb/SANT domain 0.0027
Further Details:      
 
Domain Number 2 Region: 75-107
Classification Level Classification E-value
Superfamily BRCT domain 0.0000294
Family BRCT domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002177
Domain Number - Region: 518-556
Classification Level Classification E-value
Superfamily UBA-like 0.00153
Family TS-N domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002177   Gene: ENSGACG00000001667   Transcript: ENSGACT00000002183
Sequence length 607
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:4873430:4883237:1 gene:ENSGACG00000001667 transcript:ENSGACT00000002183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSEQQNGAKRNISPVLFMTVDGEPMTFFLRPGPAKLKLQPLITAGAGVLCKVQQPGAIL
LLEPEERGSISESTTHWFVSTQYIFDCIEKNEQLNLEDYKLNPVVVPRQSARLNNKSGRL
SYSAEDDAAILTYVSKHKSETGGNRLWQEMEKQSVTSHSWQSMKSRYKARLAKSRQLVDK
PTVVHGGASRQSLSLTEALISKEEFVKDHEETAVQKASRPEDPASAQTRLMETDQTQEEV
KHVDPQADEQPSESKCGEAAEAETSNSPHPEGPCLDPQTDTAESGEPEAEEPQTHVMSPQ
KSAPCGSPPAEPEYLHDTSSPKKSKEKQKVSPKLDQLERRATRRQLAPEMPRLPEPYSRK
LRSSTTSPGRPPASPQPSKKTNFHSCSPGTESNSAPQKKKEKRKLGILEMAIKEFEDSDE
DAGPDIQTPTEAAATRPTSAERLPPPSDTATGAVSTASSPELVASPQGDTQEAEPPAGNG
LPAPVASEAVDAPSTPSKPRAAVHTDAVLSLTQVQLDEDKQRIKELMSQTNQDLVSVTKA
LLKTSGDFSAALEQLLNPTSISGPVWNRCDDSLLFSADPEVRQQLREKYGEQDVAKRIVF
LEAEGIK
Download sequence
Identical sequences G3NA35
ENSGACP00000002177 ENSGACP00000002177 69293.ENSGACP00000002177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]