SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002187 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002187
Domain Number 1 Region: 84-118
Classification Level Classification E-value
Superfamily WW domain 0.000000000125
Family WW domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002187   Gene: ENSGACG00000001666   Transcript: ENSGACT00000002193
Sequence length 498
Comment pep:known_by_projection group:BROADS1:groupXXI:557603:579034:-1 gene:ENSGACG00000001666 transcript:ENSGACT00000002193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDSTDVTPPCKVLRRSDSPENKHTDSTSHSRAKAVHTHRARDRDGGTSYSPQENSHNHS
SLHSSNLHSNPGKTSDTPYEPGDDWSEHISSSGKKYYYNCRTEVSQWERPKEWLEREQRQ
KEATKTAVVNSFPKDRDYRREAMQASTGFTGAKSAQAEKPTATVTSQSSSGSGSMNPSSG
LPGSSSSTTVPMSPVLQSPGPALLQDPTLLRQLLPALQTALQLNNASVDMAKINEVLTAA
VTQASLQSMLHKILTAGPSAFNITTILSQAAQLSNQAQQSNQSPMSLTSDASSPRSYVSP
RISTPQTNTGPLKPLLNAQPVISQTKVCAQPGKLPSHPQPSPHQSHSSDKQHSQDTTTAS
PRTLQRQGSHRSPSPGPNHISSSSSHPPNSASAPPSASAARPSCTFTPTLATHFNENLIK
HVQGWPAEHAEKQASRLREEAHTMGSICMSENCTELKNLRSLVRVCEIQATLREQRILFL
RQQIKELEKLKNQNSFMV
Download sequence
Identical sequences G3NA45
ENSGACP00000002187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]