SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002210 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002210
Domain Number 1 Region: 18-109
Classification Level Classification E-value
Superfamily PUG domain-like 0.0000000000127
Family PUG domain 0.0048
Further Details:      
 
Domain Number 2 Region: 620-685
Classification Level Classification E-value
Superfamily RING/U-box 0.000000512
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 156-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000087
Family B-box zinc-binding domain 0.0049
Further Details:      
 
Domain Number 4 Region: 284-311
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000023
Family Ran binding protein zinc finger-like 0.0035
Further Details:      
 
Domain Number 5 Region: 338-362
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000392
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002210
Domain Number - Region: 498-535
Classification Level Classification E-value
Superfamily UBA-like 0.000743
Family UBA domain 0.022
Further Details:      
 
Domain Number - Region: 244-269
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000916
Family Ran binding protein zinc finger-like 0.0042
Further Details:      
 
Domain Number - Region: 791-855
Classification Level Classification E-value
Superfamily RING/U-box 0.00742
Family RING finger domain, C3HC4 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002210   Gene: ENSGACG00000001689   Transcript: ENSGACT00000002216
Sequence length 985
Comment pep:novel scaffold:BROADS1:scaffold_213:39198:48194:1 gene:ENSGACG00000001689 transcript:ENSGACT00000002216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRENTACSSTLEVLESLSRLVKALSILEKYGCNLTSPARPRYWRSVKHNNPVFRSTVDA
VKGGRAVLFLYGYTSQQADGLSFPDDVSQPDAAHVAAVTLEVMTLRTEVDMLVKGTHPHP
ESFRDVVPFLVPPVRTNAPTPLPYKSPPGERPPIGDCSLCGAAPSLVCPSCDGQAFCDAC
DDLFHRHPSRDQHKRDQLQQPPPALPLAPRPPGAQPEPRGSPQSLQVRRDQEKSREEPKS
PSLSPWQCARCTTVNATRAVLCATCERPRLAAAQETPPPVPPSPNTEWRCRSCTVVNQGS
SILCEVCERPRLATRPPAAPLPTSPGTPPESGDKFCRSVKWMCQFCTYVNASPAVVCEMC
NLGGSPPASLQQTPAGAKDQAASPPRPQPKARVDVEVKRQKMMRDDGLRLVQQIREAEKR
GVSAEEVYAAIGMCGGSNTTSPCDWLTSELPHLLDEICAMAASVQGDGAKLSRAEAKLAW
LSAGGDTNKAVTQLLRDRQVKMKELHSLGFREASRCEEALRLSGGEVKGALSLLQRPLLE
PFHQRIWTDQPEPPIDPQHPDKQRTCRRLLALYELPSWGRCELVLSLLQEPGVTFSLEDV
VQAVKESHDKDFIKRLLINECPCCLSPFPRSKMQSLTSCQCSVCHECFRLHFTIAVRDKH
IRDMVCPVCSEPDINDPQQLDSYFSTLDIQLRNCLQPDEYELFHKKLTEHALMKDPKFLW
CCHEYFIVINNIMMFLLTSPPPHNTFTASVKGPAIANRGTALARASIKIPSISHNRSGRR
KAHRRKKNFGLPCPSCRFQYALTKGGCLLFSCSQCRYQFCSGCNNPYHKTVCKAAQCICP
GLHAHHPRDCLFYLRDWEPPRLQALLQRSGVDFNTDPSDGSQSDPEACCVMEQKDDKVES
PCGLRTQPGQAGLCEKHYKEYLVSLINAHSLDPAPLYEASEVIRACERYLVDTQRGGDED
EDVFLARLLKKLMEVPLGEKVPRNK
Download sequence
Identical sequences G3NA67
ENSGACP00000002210 ENSGACP00000002210 69293.ENSGACP00000002210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]