SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002420 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002420
Domain Number 1 Region: 564-932
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.27e-133
Family Hect, E3 ligase catalytic domain 0.00000000000127
Further Details:      
 
Domain Number 2 Region: 23-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.84e-17
Family PLC-like (P variant) 0.00049
Further Details:      
 
Domain Number 3 Region: 468-507
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000129
Family WW domain 0.0004
Further Details:      
 
Domain Number 4 Region: 363-398
Classification Level Classification E-value
Superfamily WW domain 0.000000000000167
Family WW domain 0.0013
Further Details:      
 
Domain Number 5 Region: 398-432
Classification Level Classification E-value
Superfamily WW domain 0.000000000000282
Family WW domain 0.0012
Further Details:      
 
Domain Number 6 Region: 510-545
Classification Level Classification E-value
Superfamily WW domain 0.00000000000686
Family WW domain 0.00049
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002420
Domain Number - Region: 314-375
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 0.0523
Family Amidase signature (AS) enzymes 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002420   Gene: ENSGACG00000001862   Transcript: ENSGACT00000002428
Sequence length 938
Comment pep:known_by_projection group:BROADS1:groupXXI:1920400:1934021:-1 gene:ENSGACG00000001862 transcript:ENSGACT00000002428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAPSRAESSHNHRGSSQLHAIVSCAKIKRKKNRFVTAIYVEVTADGESRRTTKSHSSS
SPKWDETLTLNVTPHTQVDFKVWSHNTLKADTLMGKATLDLIQALEQHDRKLENVKEVLK
LTVEQKGALVPAGELTVYLDGLTVSGQEELAPLTNGYTPEAHQNGNALRENGDSSSSSSR
AANSTVNGTDLGPRSSSCSVSNGVEGQEPSSSCSPAPHHVVNSDAPPNSTPLHQPSDSDT
ESRTVNGESCDAALSPSSATTDDALPDADTAPDSTPQTLPTSTQAPASSSPSAAKPVDGA
AAAAASAAGQGAQTTTTSSSSSSSHPPALEEANPSGGAGGSSSGSATAPTEGAKPTQQVP
NAGAADPLPPGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRIYYVDHN
TRTTTWQRPTMESVRNFEQWQSQRSQLQGAMHQFNQRYLYSASMMSAENDPLGPLPPGWE
RRVDSNDRVYFVNHSTKTTQWEDPRTQGLQNEDPLPEGWEIRYTREGVRYFVDHNTRTTT
FSDPRTGKSSVTKGPQIAYERSFRWKLAHFRYLCQSNALPSHVKITVSRQTLFEDSFQQI
MALKPYDLRRRLYVIFRGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKSNYCLQIN
PASAINPDHLSYFCFIGRFIAMALFHGKFIDTGFSLPFYKRMLNKKLILKDLESIDSEFY
NSLIWIRDNNIEECSLEMYFSVDMEILGKITSHDLKPDGTNVLVTEENKEEYISLMAEWR
FSRGVEGQTKAFLDGFNEVVPLQWLQYFDEKELEVMLCGMQEVDLQDWQRNTVYRHYTRN
SKQIIWFWQLVKEVDNEVRLRLMQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWL
PRSHTCFNRLDLPPYKSFDQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences G3NAS4
69293.ENSGACP00000002420 ENSGACP00000002420 ENSGACP00000002420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]