SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002437 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002437
Domain Number 1 Region: 766-933
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 9.94e-41
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 
Domain Number 2 Region: 908-1010
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.28e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 71-115,235-321
Classification Level Classification E-value
Superfamily PH domain-like 1.16e-24
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 5-62
Classification Level Classification E-value
Superfamily PH domain-like 0.0000635
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002437   Gene: ENSGACG00000001878   Transcript: ENSGACT00000002445
Sequence length 1157
Comment pep:known_by_projection group:BROADS1:groupXVI:2568438:2588769:1 gene:ENSGACG00000001878 transcript:ENSGACT00000002445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRTSFSRFIHNSKTLTYFGYLTRGQRDNPNREMSCHVSRACDPTQVSEVISSIRQVSKSA
LKADAKPKQEADDAFYNSQKFEVLYCGKVTVLQKKAAVTLIDDCIDKFRLHEVERKRLRL
PGGRRGSTEGACVEFLMGGGGEPISSALNESIEYTEGPGGKAVSNGASQSSLRGAFPECI
LEDSGFEEPQEFRARCSSLAGSLQRKPGEGVIMGPLRRRHSSAPNHVQPSDSDRNRTMLF
QVGRFEVNLISPESKTVVLEKNFKDISSCCQGVKRSDHFGFIGRDKCESGPSQYVCYVFQ
CASESLVDEVMLTLKQAFTTAAALQSNQTQVQICEACPMHDLHKLCERIEGLYPPRAKLA
IQKYLSQLSDNEQAEIFERVQRLKPGSDQEENELVVLHLRQLCGTKQKSHLHIGEVPQNA
ANSSSAGDGSATGSRFTLDVLKNKARTSLTSSLENIFSRGASRMRGRLGSMGSVSSFEKV
SVLDWQDEESPGHSPPGSPPAFPDGDPEGGQQFRRRAHTFSHPPVKKRISFEGQSASKQA
PLRRQQSVNPELLQGRTRSVSESESTFGLPSSFSAPTFLKSIYQGSLGSLSSLADSGTLK
SNGEGRKRNLSICSSDSLSGGLPPTPRRVSWRQKIFLRVASPMNKQPASMQHSDHYGSRE
LLPLSPCGTGSGLDPLGRPLPPAGSSLSGERPKRTGADYRALWKTAIHQQILLLRMEKEN
QRLEASRDELHIRKMKLNYQEVGQCSTETLALWDRKLTAPGRTTLAQNKEELHGALCQGV
PKSRRGEVWLLLSHQYRLRHRLPQRQQALDVSYQDLLKQLTAQQHSILVDLGRTFPTHQY
FSAQLGAGQLSLYNLLKAYSLLDTEVGYCQGISFVAGVLLLHMSEEQAFDMLKFLMYDLG
IRQQFRPDMVSLQVQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAAPWFLTLFASQFPLN
FVSRVFDFVFVEGTGVIFKVALCLLSSREGEIVECDSFESIVDYLKTTLPALSQTQMEET
IAKVTEMDISKQLHAYEVEYHVLQDEMLEAGPLPDDSDRLDKLEKTNVQLKKQNMDLLEK
LQAARQKIQTLETSVENFLSRESKMKHMIRSLEQDRAAHQKTIERMRSCVPPDALTDVEM
TQFKTGPNGKAKTAAKK
Download sequence
Identical sequences G3NAU1
ENSGACP00000002437 ENSGACP00000002437 69293.ENSGACP00000002437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]