SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002594 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002594
Domain Number 1 Region: 744-954
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.71e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000588
Further Details:      
 
Domain Number 2 Region: 232-500
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.57e-29
Family FCH domain 0.032
Further Details:      
 
Domain Number 3 Region: 669-726
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000733
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002594   Gene: ENSGACG00000001997   Transcript: ENSGACT00000002603
Sequence length 1322
Comment pep:known_by_projection group:BROADS1:groupXXI:2152810:2178889:1 gene:ENSGACG00000001997 transcript:ENSGACT00000002603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRQSSGGGGGNNDNNGSGGGTKLPLGSRLSNSSSRSSGPAGAKVGSGSSDGTDAPASDP
IYIMQLVSDVRKFADVLLQLKEVFISKEHQDCLHQAAHERLGELLRVLKLIIGKHQSLNS
VDILSTAGTVIATVKGVNFKEVNEENKQKLFGEIYAAIDTLAFTFGNVVSDFLMGDVENG
SVLGLPLTKRSRSFENLSVESGGSGPEKDDLPGPSQPVRAEEVDRTLQRLDSGVESALLY
AKAWSKYTKELLAWVEKRLSMDVECAKSYAKMAESAKTLASQQEFMPFCEIYMAAFKNDI
EYSQLVLQTAAVLQSNKFIRPLLARKNELDKLRKEVKEQWQREQKKMNEADSALKKARLL
QVQRQEEYEKAKVSTSRLEEEQIGGAGGAAAAKQLEKRRRLEEEAQQKADEAREHCKACQ
IDVGDKRVDLTNAKSEIITQIRVMVSQCDLTLKAVSVNWFQLQQAQVVSLPVNHQSLCEN
AKLYEPGQRYIDFVRGLPTDGPRLESHSFDSAVTHGTGMLFSKRLLSGSHSSHSNLSQAS
VTSDLLGADDMESPVTAQHAKIAERHSNSSTDIQALRTQASFRPWASASHGGGMCSDSES
AGGSSESRSMDSPTASPGDFKRRLPRTPSTGTMSSADDLDDREPPSPCDNGVSEMIIETA
SSPGPFRNTQMSKAAQTHKLRKLRAPSKCRECDGLVVFHGAECEECSLACHKKCLETLAI
QCGHKKLQGKLHLFGIDFTQAAKNSQDGIPFIIRKCTSEIENRALNIKGIYRVNGAKSRV
EKLCQAFENGKDLVELSELYPHDISNVLKLYLRQLPQPLILFRYYNDFIGLAKESQSIIV
EELEALRRSPTSVTPAQVSVDLNRILFKIKDLLRQLPPVHYKTLQFLIEHLHRVTEQSEE
NKMTASNLGIIFGPTLIKPRQADAEVSLSSLVDYPYQALVVELLIRHYQMIFDTPLSPLS
PTSPAKIDGRPRHAPQEKEQLLSRHSKSLGDIKEQSSKVYKRHSSMIPSSHLLAEVHESM
PRLNGSDFERGQYYKNSQPNNVHTMLLKMSMFNLLHIPVPRVQLRHPRNKLSSRPASLPA
ERVAGRGQIDENNTRNSADQDDRKGAGCDQSIEEVDETESTKSRAGTHYRRTFIDTQTLR
RTWDKQYKHDVAARTVRIVASSPSESTAVDASDVSASVPVSSSSFTLGTTASISTIFPNR
PYTVAVRPSRILRREDNLTKYNTVATGFRAPRTLQPPPGTFYKPPSGSKAKELHSCPSAN
SIEIEVSVDEPLEEDDEADQAAMSQSPSSSLEELSPDQAKPVYQRLRPRRLQEVERREAH
FV
Download sequence
Identical sequences G3NB98
ENSGACP00000002594 ENSGACP00000002594 69293.ENSGACP00000002594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]