SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002626 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000002626
Domain Number - Region: 4-77
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00118
Family Ubiquitin-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002626   Gene: ENSGACG00000002012   Transcript: ENSGACT00000002635
Sequence length 308
Comment pep:known_by_projection group:BROADS1:groupXXI:2210030:2214589:-1 gene:ENSGACG00000002012 transcript:ENSGACT00000002635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCFLQVKILDAKTKEQLCFLDKVDPRSTIRDIKSLFHKAYPRWYPARQALMLDAKEKSLR
DEEVLQNLPVGTTATMYFTDLGPQLGWTVVFLAECIGPLLIYLLFYFRVPYIYSHNYAFT
SSPHPVVRIAFACHTFHYVKRLIETIFVHRFSHGTMPLRTIVRNCVYYWGFSAWLAYYIN
HPLYTPPSYGELQINYALVIFVMCELGNFSIHLTLNNLKGEGSRSRRFPEPTKNPFTWLF
IFVSCPNYSYELGAWVGFSIMTQCLPVAFYTLLGFIQMTIWAKGKHRAYSREFKDYPTLR
MAIIPLIL
Download sequence
Identical sequences G3NBD0
ENSGACP00000002626 ENSGACP00000002626 69293.ENSGACP00000002626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]