SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002680 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002680
Domain Number 1 Region: 193-395
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-52
Family DBL homology domain (DH-domain) 0.000000395
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.09e-37
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 
Domain Number 3 Region: 381-542
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-34
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 4 Region: 638-768
Classification Level Classification E-value
Superfamily SH2 domain 5.4e-27
Family SH2 domain 0.00067
Further Details:      
 
Domain Number 5 Region: 787-846
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 6 Region: 592-667
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000114
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002680   Gene: ENSGACG00000002060   Transcript: ENSGACT00000002689
Sequence length 849
Comment pep:known_by_projection group:BROADS1:groupXXI:2604075:2667581:-1 gene:ENSGACG00000002060 transcript:ENSGACT00000002689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCALWLINCKVLPANHRVTWESAQVFDLAQTLRDGVLLCHLLNNLRPQSINLKEI
NLRPQMSQFLCLKNIRTFLVACGDVFGMKKSELFEAFDLFDVRDFGKVMDTLSKLSHTAI
AQQTGIRPYPSEESVEDEDIYNHLEDLIDENGVEDEEDLYDCVYDDEDGGEIYEDLMKTE
AIPPPAFQKQAETDIRSCCLTEIKQTEEKYTETLESIEKHFMTPLTMFLSMAEMEKVFVN
IPDLVKVHKCLLVEILESVNHRSAQNLFQIFITFKERLLIYGKYCSHVETAIAGLDDICK
DREDVRMKLEECSKRANYGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLRTA
LDAMKDLAQYVNEVKRDNETLREIDQYQKSIENLNQPLRNYGRPKGDGEVRVSSVDKRAK
QDRHIFLFDAAVIVCKRRGDNYEMKEVIDLHLFKITNNPTSDKENRKWSYGFYLTHNQGQ
SGFEFFFKTKELKKKWLDQFGMAISNIRPENATSNFHEFHMHTFEKITSCNSCHMLLRGV
FNQGYLCSKCGLGAHKECLGRFGSCGKTENGGKTSDMLNEKKASGNQLNMSSVVDPSRPK
MLVIRNYFGVPSPTSGPPLSIQAGDIIELICADIHSPWWQGKVVTTKEVGFFPSDAVKPC
PCVPKPIDYSSQTWFAGPMERLQAEAELINRVNSTYLVRHRSREYTEYAVSIKYNNDVKH
IKILTKDGCFYIAENKKFRSILELIEYYKHHSLREGFRSLDTTLKFPYQEPENADMQRLN
RSGSTMFTPKVIGVAIARYDFSSRDTRELSLQEGDVVKIYTKSGANGWWRGEVNGRVGWF
PSTYVEDGE
Download sequence
Identical sequences G3NBI3
69293.ENSGACP00000002680 ENSGACP00000002680 ENSGACP00000002680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]