SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002684 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002684
Domain Number 1 Region: 415-623
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.15e-54
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 192-324
Classification Level Classification E-value
Superfamily BRCT domain 6.54e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 102-219
Classification Level Classification E-value
Superfamily BRCT domain 8.07e-19
Family DNA ligase 0.033
Further Details:      
 
Domain Number 4 Region: 614-757
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000228
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002684   Gene: ENSGACG00000002063   Transcript: ENSGACT00000002693
Sequence length 876
Comment pep:known_by_projection scaffold:BROADS1:scaffold_56:738246:768110:-1 gene:ENSGACG00000002063 transcript:ENSGACT00000002693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSALTSGTAPSLLVDTSVYDSRIAETTKDHVFLGLACEGGEDMLPKVETRVVLVGAA
GRNAALVKALQDINTPCILTDSVQEFADGENTDFETVFVLADFDSPNYNYLYKRDNRIVG
PPVLLHCAAKEEPLQFSCRPLYCTTMLNLSLCFPGFRNKEEMKKLVNLVHHMGGTIRKDF
STKVTHLVAYSTHGEKYRLAVCMGTPILTPSWIHKAWERRDDVHFNAAEEDFRTEYKVPP
FQDCVLSFWGFSDEEKTNMEERTLKHGGKYLEVGDERCTHMVVEENSVKELPFSSNKVYV
VKQEWFWGSIQMDARAGESMYFYEKNDSPAMKKAVSLLSLTTPNSNRKRRRLRDTLAQLT
NETEISPFPPPRKRPSAEHSLSIGSLLDISNTPETCKALAETPRPSKSSTPALCKQSARW
QVSKELYQTESNYVDILSTILQLFKIPLEKEGQVGGPILAQEEMKNIFGSIPEIYDVHTR
IKSNLEELLTDWSEDKSVGDIILKYSKELVKAYPPFVNFFEMSKDTIVRCERQKPRFHAF
LKINQSRPECGRQTLVELLIRPVQRLPSVALLLNDIKKHTSDDNPDKITLEKAIESLKEV
MTHINEDKRKTEGQKQIFDVVYEVDGCPANLLSSHRILVHRVETIALGEQPCDRGEHVTL
FLFNDCLEIARKRHKVINTFKSPLGQTRPPPPLKHIALMPLSQIRRVLDLQDTEDCVNAF
ALVVRPPTEQENLLFSFQLAGEETVKSAWLRTLCRHVADTICKADAEDLIRCTDPDSLQV
STKDMDSTLSKASRAIKKTSKKVTRAFSFTKTPKRVIQRAFMANSTPEEKGQRLSCENRV
GSSSTLAARPSPSMVNLPSMFEKKYHTFSRSSTHLF
Download sequence
Identical sequences G3NBI7
ENSGACP00000002684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]