SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002686 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002686
Domain Number 1 Region: 446-654
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-54
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 223-355
Classification Level Classification E-value
Superfamily BRCT domain 7.71e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 133-250
Classification Level Classification E-value
Superfamily BRCT domain 9.38e-19
Family DNA ligase 0.033
Further Details:      
 
Domain Number 4 Region: 645-788
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000264
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002686   Gene: ENSGACG00000002063   Transcript: ENSGACT00000002695
Sequence length 974
Comment pep:known_by_projection scaffold:BROADS1:scaffold_56:740823:768110:-1 gene:ENSGACG00000002063 transcript:ENSGACT00000002695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSALTSGTAPSLLVDTSVYDSRIAETTKDHVFLGLACEGGEDMLPKVETRVVLVGAA
GRNAALVKALQAIRVMEVPVVKIREGEPGAEEKMMIKSIVNMDINTPCILTDSVQEFADG
ENTDFETVFVLADFDSPNYNYLYKRDNRIVGPPVLLHCAAKEEPLQFSCRPLYCTTMLNL
SLCFPGFRNKEEMKKLVNLVHHMGGTIRKDFSTKVTHLVAYSTHGEKYRLAVCMGTPILT
PSWIHKAWERRDDVHFNAAEEDFRTEYKVPPFQDCVLSFWGFSDEEKTNMEERTLKHGGK
YLEVGDERCTHMVVEENSVKELPFSSNKVYVVKQEWFWGSIQMDARAGESMYFYEKNDSP
AMKKAVSLLSLTTPNSNRKRRRLRDTLAQLTNETEISPFPPPRKRPSAEHSLSIGSLLDI
SNTPETCKALAETPRPSKSSTPALCKQSARWQVSKELYQTESNYVDILSTILQLFKIPLE
KEGQVGGPILAQEEMKNIFGSIPEIYDVHTRIKSNLEELLTDWSEDKSVGDIILKYSKEL
VKAYPPFVNFFEMSKDTIVRCERQKPRFHAFLKINQSRPECGRQTLVELLIRPVQRLPSV
ALLLNDIKKHTSDDNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGCPA
NLLSSHRILVHRVETIALGEQPCDRGEHVTLFLFNDCLEIARKRHKVINTFKSPLGQTRP
PPPLKHIALMPLSQIRRVLDLQDTEDCVNAFALVVRPPTEQENLLFSFQLAGEETVKSAW
LRTLCRHVADTICKADAEDLIRCTDPDSLQVSTKDMDSTLSKASRAIKKTSKKVTRAFSF
TKTPKRVIQRAFMANSTPEEKGQRLSCENRVGSSSTLAMSRSASTFSLTDSTKSGAVVQR
SNSLDHPPIRARASVCIRPPSSPPVAAHPAPDASTPAVLHPKSSHPGSRPQARFLAPLPV
NESALSSPRRETLL
Download sequence
Identical sequences G3NBI9
ENSGACP00000002686 69293.ENSGACP00000002686 ENSGACP00000002686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]