SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002690 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002690
Domain Number 1 Region: 390-598
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-54
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 159-290
Classification Level Classification E-value
Superfamily BRCT domain 7.27e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 69-186
Classification Level Classification E-value
Superfamily BRCT domain 7.85e-19
Family DNA ligase 0.033
Further Details:      
 
Domain Number 4 Region: 589-732
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000225
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002690   Gene: ENSGACG00000002063   Transcript: ENSGACT00000002699
Sequence length 791
Comment pep:known_by_projection scaffold:BROADS1:scaffold_56:741852:769147:-1 gene:ENSGACG00000002063 transcript:ENSGACT00000002699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYCSDQNSLCKNMLPKVETRVVLVGAAGRNAALVKALQDINTPCILTDSVQEFADGENTD
FETVFVLADFDSPNYNYLYKRDNRIVGPPVLLHCAAKEEPLQFSCRPLYCTTMLNLSLCF
PGFRNKEEMKKLVNLVHHMGGTIRKDFSTKVTHLVAYSTHGEKYRLAVCMGTPILTPSWI
HKAWERRDDVHFNAAEEDFRTEYKVPPFQDCVLSFWGFSDEEKTNMEERTLKHGGKYLEV
GDERCTHMVVEENSVKELPFSSNKVYVVKQEWFWGSIQMDARAGESMYFYEKLMDSNNDS
PAMKKAVSLLSLTTPNSNRKRRRLRDTLAQLTNETEISPFPPPRKRPSAEHSLSIGSLLD
ISNTPETCKALAGVHKTPRPSKSSTPALCKQSARWQVSKELYQTESNYVDILSTILQLFK
IPLEKEGQVGGPILAQEEMKNIFGSIPEIYDVHTRIKSNLEELLTDWSEDKSVGDIILKY
SKELVKAYPPFVNFFEMSKDTIVRCERQKPRFHAFLKINQSRPECGRQTLVELLIRPVQR
LPSVALLLNDIKKHTSDDNPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVD
GCPANLLSSHRILVHRVETIALGEQPCDRGEHVTLFLFNDCLEIARKRHKVINTFKSPLG
QTRPPPPLKHIALMPLSQIRRVLDLQDTEDCVNAFALVVRPPTEQENLLFSFQLAGEETV
KSAWLRTLCRHVADTICKADAEDLIRCTDPDSLQVSTKDMDSTLSKASRAIKKTSKKVTR
AFSFTKTPKRV
Download sequence
Identical sequences G3NBJ3
ENSGACP00000002690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]