SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002696 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002696
Domain Number 1 Region: 601-781
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-48
Family DBL homology domain (DH-domain) 0.000000169
Further Details:      
 
Domain Number 2 Region: 785-917
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-30
Family Pleckstrin-homology domain (PH domain) 0.00000109
Further Details:      
 
Domain Number 3 Region: 284-421
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000117
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 54-193
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000144
Family CRAL/TRIO domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002696   Gene: ENSGACG00000002072   Transcript: ENSGACT00000002705
Sequence length 918
Comment pep:known_by_projection scaffold:BROADS1:scaffold_56:801936:863977:-1 gene:ENSGACG00000002072 transcript:ENSGACT00000002705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTVGAQFDLMCHWGSAVSVFLPTDEIMQQEIRPLLAEDIIEQLHLQFASLSGGRGTDGAP
IIIFPEFSGFSEVPEDDFLNVVTYLTSIPSLDAASIGFIIIIDRRKDKWSSVKASLSRIA
GAFPGNLQLVLVLRPSRFFQRAIADIGIKLHKDDFKMKVPIVMLNSLSDLHGYVDKGQLT
RELGGNLEYCHSQWIHHRTAIENFAMTVKTTAQMLEKFGTDLAETELPNDVQCTKDLLTA
HTDKHGQLKCLLKLALKQGTTLLGWIKEQAARSENHQLNTDEMENQTTVERLLAQLDETE
NAFEHFWCKHHLKLEQCLQLRHFEQDFREVKVSLDSLMDILTSLSDIGDCVARVEHLLKE
LKALEEKALPTLEKAQLHALHGDQLIQSNHYAVDSIRPKCVELRRVCDDFSNEAKKKTDL
LSKSLQIHMGIEKVNQWCESGIYLLASQAVDKCQSQEGAELALTDIQHFLESAEKNQLTE
LRNLQNKYEVVLSDDIKANVLKALQRLEDVQEMFEKRHVSLKRLSAKQTRPVQPVAPRPE
SSPKRPSPKNPPRTTGNQQRVCESGASTSEPQKRSWFELNIGVGGRGRAGSSPTSLAVNG
AHIMTELIETERLYVEELQSIMEGYFAALDNSELIHLIPPSLDNQRDVLFGNLPEIYEFH
NRTFVRELENCADKPELVGTCFLKRKEELQVYEKYCQNKPRSEVLWRQCGDSLFFQECQK
KLDHKLSLDAYLLKPVQRITKYQLMLKEMLKCSKGEGTVELEEALSTMLDIIKSVNDSMH
QIAITGFEGNLSELGKLLMQGSFNVWTDHKKGHSKVKDLARFKPMQRHLFLYDKTMLFCK
KREETTDGHEKTPSYSFKHSLKMSSVGITENVKGDIKKFEVWYNGREEVYIIQPSMDVKN
MWVSEIRKVLTGQLEACR
Download sequence
Identical sequences G3NBJ9
ENSGACP00000002696 ENSGACP00000002696 69293.ENSGACP00000002696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]