SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002740 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002740
Domain Number 1 Region: 96-209
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000146
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002740
Domain Number - Region: 269-287,434-452
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00209
Family Di-heme elbow motif 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002740   Gene: ENSGACG00000002110   Transcript: ENSGACT00000002750
Sequence length 464
Comment pep:known_by_projection group:BROADS1:groupXVI:3674592:3692242:1 gene:ENSGACG00000002110 transcript:ENSGACT00000002750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALQALFFNSTRLQLRAANQWEAAEWRRLMWEKVQAARPARRESHQRKAGSEKQQVVNLTA
AASPSALDTRPDGDGDALSPQPKYGVLSRPTSLPLFNQRCQDVLKAGVLHQLSSQNSRAF
TFVLTRSALRAFATEGRGSVSQPVLQFSLASCSAVRHSREPEHGEPWTHRGDCFQVAFPK
EVLRLRADDHFKAKEWVEALRDAVGAHRPAKEEAGGSGEGAPALQGVLLRSKPCRERRQR
EAQRAKRQSVTTSFLSILTCLAVEKGLTAQSFRCAGCQRPVGLSKGKAKVCFYSGWYYCQ
SCHQDNAFLIPARLLHNWDTSRHKVSKQAKEFLEFVYEEPLLDVQQLNPCLYEHCEPLST
VLRLRQQLQSLRAYLFSCRATVAEDLRRRIFPREYLLQHIHLYSIADLQQVIDGKLAPFL
SKVIKFASAHVFSCSLCREKGFICELCHNEQVIYPFQESATKRY
Download sequence
Identical sequences G3NBP3
69293.ENSGACP00000002740 ENSGACP00000002740 ENSGACP00000002740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]