SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002761 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002761
Domain Number 1 Region: 279-572
Classification Level Classification E-value
Superfamily BEACH domain 7.85e-115
Family BEACH domain 0.00000011
Further Details:      
 
Domain Number 2 Region: 618-917
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.6e-57
Family WD40-repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 189-284
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000221
Family GRAM domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002761   Gene: ENSGACG00000002116   Transcript: ENSGACT00000002771
Sequence length 920
Comment pep:known_by_projection group:BROADS1:groupXXI:2727862:2736985:1 gene:ENSGACG00000002116 transcript:ENSGACT00000002771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRFTLVVHEHDLTLLLFSSRFSLLLLDLEEYYFEQHTAYYATTSSNKEKKVRGSLKVCSR
SIIFDPEDLTEPILKITLRDCKKIEFLDRENNPFHEPRPSAISILCVQVIYIKESNVIAP
YRNERGAKKVSFQLEGWSKTEDVVQTLLQLHRASCLEKLGDQTAMIAANLQSRLARSFFD
KNCFQSVAEKPHMECAVEMVMPLVSNPGHVCITDESLYFQPLNGYPEQVIQIQLHRVRRI
YKRRHGLRPLGLEVFCTENDFCSDIYLKFYKTADRDEIYYYIATFLENHVTEHTAESYML
QWQRGHLSNYQYLLHLNNLADRSCNNLSQYPVFPWVISDYASERLDLTNAATFRDLSKPV
GALNRERLDQLLARYRGMPEPRFMYGSHYSSPGYVLFYLVRVAPEHMLCLQNGRYDHADR
MFNSIGDTWKNCLEGATDFKELIPEFYGTDCGFLENKLRLDLGRRQNGSLVGDVVLPPWA
SDTGDFLQKHRTALESQYVSEHLHEWIDLVFGFKQRGGEALAAHNVFHPLTYEGGIDCDS
IEDPDQRIGMLTQILEFGQTPKQLFTTPHPQRITPRFHNITRSPSSNSPVGDLSPASQSE
DSSFEDLTEESRKLAWANMGNLKPISSHKIHKEAVTGIAVSHDGSAIFSTSQDTTLKMFS
KELKDFQRSMSFSNMALSSCLMLADGKTVVCSSWDNHVYFYSVPFGRRQDTLMGHDDAVS
KMCWFDDRLYTASWDSTVKVWQCASDGSSSHKRSQFQLLAELEHDAGVNTIGLNPAGTLL
VSGCKDGAVTIWDTSSHATLQQIHCHTGTIHHVAFSPDSRHVLSVGADSCMKVTDVQTGM
VISTVKAVEEQRCFCWDGNLVLCGGQSGDLLLWDLLSNTVIQRIPAHSGAVTAMWMSELC
STVITGGDDRQIILWKLLSP
Download sequence
Identical sequences G3NBR4
69293.ENSGACP00000002761 ENSGACP00000002761 ENSGACP00000002761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]