SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002773 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002773
Domain Number 1 Region: 188-300
Classification Level Classification E-value
Superfamily PH domain-like 1.74e-34
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 2 Region: 107-202
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-24
Family PDZ domain 0.00032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000002773
Domain Number - Region: 319-433
Classification Level Classification E-value
Superfamily PH domain-like 0.0113
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002773   Gene: ENSGACG00000002134   Transcript: ENSGACT00000002783
Sequence length 540
Comment pep:known_by_projection group:BROADS1:groupXIX:584241:596539:-1 gene:ENSGACG00000002134 transcript:ENSGACT00000002783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRAPPAASAGVGMAVWTRADKRGQLDLLLRDRWIRVAAELTRETLTLTAEAEATGPGGNH
WDYNGSSAAPRNGVPNGNEPGASPGNPARVPPSGPEQLQSQNQGPDGSSEAVRKVRVVKQ
ESGGLGISIKGGRENRMPILISKIFPGLAADQSRALRVGDAILSVNGSDLREATHDLAVQ
ALKKAGKEVTLEVKYIREVSPLFKKPSLVADLPWDGARAQSPSCSGSEDSGSPKHCGASP
RDRKVMSLKMCFISRNLTMPDLENRLLELHSPDGQHTVVLRCKDGATANSWFTAVHTNVA
ALLPHTLAHVNAYLGASSPAHPHLQHIGWLAEQVQLEGGRQQHKPVVMALTEKDILLFES
VPWSRESWSAPLLTHPLLATRLVQCRGARGSPPQGSDTAFVTRTGTGRGIESHVFRVETQ
WDLSTWTRALVQGAHAAAELIKEVSIGCTLNRQDVRLTLHYEKGFTVTREPADPPGGAVL
FRYPYEKLKMSADDGMRNLYLDFGGPEGEMVFDLHSGPKPVVFVLHSFLSAKLTRMGLLT
Download sequence
Identical sequences G3NBS5
69293.ENSGACP00000002773 ENSGACP00000002773 ENSGACP00000002773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]