SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002819 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002819
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.62e-46
Family GABARAP-like 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002819   Gene: ENSGACG00000002154   Transcript: ENSGACT00000002829
Sequence length 126
Comment pep:known_by_projection group:BROADS1:groupXIX:642454:645877:1 gene:ENSGACG00000002154 transcript:ENSGACT00000002829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKWMFKEDHSLEHRCVESAKIRNKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQ
FMWIIRKRIQLPSEKAIFLFVDKTVPPSSLTMGQLYEKEKDEDGFLYVAYSGENTFGFKA
FYTTHG
Download sequence
Identical sequences G3NBX1
ENSGACP00000002819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]