SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002925 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002925
Domain Number 1 Region: 38-162
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002925   Gene: ENSGACG00000002256   Transcript: ENSGACT00000002936
Sequence length 182
Comment pep:known_by_projection group:BROADS1:groupXIX:707287:709986:-1 gene:ENSGACG00000002256 transcript:ENSGACT00000002936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLDGKIRRLLGEEFQEKVPFLSPLEGNIYLRLDSDGHSDVQHQGFLTMFELVGGFGVWR
RRYFVLVGCDMFHWNNPNDRESKEAEGSVSLSSSRSRCVRSVKRDACARPFTFELVSSVP
EQQDAGAKLWFSADSKQESLDWMEKLNQSLLDFNTWRQTSAAPVSAGQSDACSSGKLRES
IL
Download sequence
Identical sequences G3NC76
ENSGACP00000002925 69293.ENSGACP00000002925 ENSGACP00000002925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]