SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002977 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002977
Domain Number 1 Region: 8-414
Classification Level Classification E-value
Superfamily Ras GEF 4.18e-90
Family Ras GEF 0.00062
Further Details:      
 
Domain Number 2 Region: 487-546
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.84e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0009
Further Details:      
 
Domain Number 3 Region: 420-489
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000227
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002977   Gene: ENSGACG00000002277   Transcript: ENSGACT00000002988
Sequence length 661
Comment pep:known_by_projection group:BROADS1:groupVI:314550:336332:1 gene:ENSGACG00000002277 transcript:ENSGACT00000002988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSATLGKAASLDALLNACIHAFDDDGDLKANLLPRTLLLMHRWYITSSEMLEETLCFRY
RESKGETCQRTRLKICYMMRYWIVTFPAEFNLDLGLIQITEEFRDVAAHLSCEEHLKLLD
ISTIPSYDWMRKLTQRKKQPKKGKASLLFDHLEPMELAEHLTYLEFKSTRRISFNDYHSY
VIHGCLVENPTLERSIALFNGVSQWVQLMVLSKLTPQTRAEVITKYIHVAQKLLQLQNFN
TLMAVVGGLSHSSISRLKETHSYLAPEVVKIWSEMTELVSSNNNYSCYRKAFNECQGFKI
PILGVHLKDLIAVHVIFPDWVHDSSQVNLVKMHQLYMTFNELVSLQSAVAQVEPNMDLIY
LLTLSLDLYYTEDEIYELSLLREPRNPKSLHISPTTPNKPLVPLDWASGFTTKPDPSVVN
KHIRKVVDSVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMIAYF
LRANPLLQSKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGVNCHKQCRE
LLVLACRKLICYASPARLTHSSLPSSPAMPTCKDDDEVFEFPSVTSTHPAMDTQSITLMT
GSSQKISVRLQRATTSQATQTDPLWAEHSWGATGGGSHTFPKMKYRTNRKTSKNKGFSRW
E
Download sequence
Identical sequences G3NCC8
ENSGACP00000002977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]