SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003055 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000003055
Domain Number - Region: 39-104
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0126
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003055   Gene: ENSGACG00000002351   Transcript: ENSGACT00000003066
Sequence length 139
Comment pep:known_by_projection scaffold:BROADS1:scaffold_54:1136115:1139609:-1 gene:ENSGACG00000002351 transcript:ENSGACT00000003066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYRGAANKSGSPEAKRARADGGQAAVEDWYSPPVLPQQPCEYWLHEDCGIWSAGVFLVKG
KVYGLEEAVRAAQETRCSACSHHGATLGCFSKGCANKYHYRCAVASADCELIEENFSMKC
KKHKNRTLRAPPGKRREDR
Download sequence
Identical sequences G3NCK5
ENSGACP00000003055 69293.ENSGACP00000003055 ENSGACP00000003055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]