SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003075 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003075
Domain Number 1 Region: 966-1065
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-26
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003075
Domain Number - Region: 425-639,968-988
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00575
Family IMD domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003075   Gene: ENSGACG00000002362   Transcript: ENSGACT00000003086
Sequence length 1076
Comment pep:known_by_projection group:BROADS1:groupXXI:4314154:4328506:1 gene:ENSGACG00000002362 transcript:ENSGACT00000003086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSLLSAWNGGGSTASVDTPSTGGAASMPSSPRLGRRSYGNHQETVPSSRSRKYSTGSLN
GMMAGEHTRSLPRLCPFQSARDNNNGALALSTLPPRRSNVAGGYKSSKDHYNGSRVASPD
LNRNSSKSAQPPANRNHIPTTDQGESVVSISLSSPKTGGSSSPRVAKKLSLTSTSSLGST
SSSPPEMDRLASRGLYTGEGPSGVDQELTGSFGFGFGERRCSFGKAGLEHGMGLGERRQS
FGKAGVTPPGGFRERRGSISSLSGKEELTDYHQHQKEERLREQEVERLERQRLETILSLC
SELGRSARDEGGPSTSPTSAVADLRKINQKLEKLQLTPSVFSDSSATNGAMGNGHVGSPG
SENGYCGDDDVQVRRRRSSGHRDSRAESPAVSLRSFAPSPSPRAQRTAEEVRRVEEERIQ
VLNNMEELEQKIKELDNQIDESAQEVELERALVEAEQESEVAALQQEKDALEALHAKMSD
LETKSQLEKEKACELLQAERGRVERLAQIVCEQRSQLDSCPEATKEPLQEQLARDCEVLD
AESKRFEDLEFQQLERESRQDEEKETQTQQLLRETADYQRSTFTRKERLLTLKKQATQIT
QQAQREKDSFLKERSTLEAMLQREKENLAMLERKYADLTGGRGFTLREGYITVSEINELY
SQLGADPKPAPAPALANGSPESESNSSRDDDTPKPPEDEHFRLMEERKRSDREVGSHLSD
TLPRKKTTPITTPQFMCATLGRSYPTKAHHPLVQSTSCGSILPRMFSLSNKESDSRRLQK
VGRQSFSFVYVSVEIVQECQPGSRAASQNNVYLDAFGYRDNQAFDTMSVDSTDSVDTSIS
ACSPDNVSSASTSNMVKLEEMERLLREAQAEKSRLLEYKDQEMEVRKQALDEERKRREDL
EKRLQEETSRRQKLIDREVKLREKQRAQSRPLTRYLPVRKDDFDLRAHIESAGHSTDTCF
HLSISEKTCRGYLIKMGGKIKTWKKRWFVFDRNRRTLSYYSDKHEAKLKGVIYFQAIEEV
YYDHLKNAHKSPNPSLTFSVKTHDRVYYMVAPSPEAMRIWMDVIVTGAEGYTQFMV
Download sequence
Identical sequences G3NCM5
ENSGACP00000003075 69293.ENSGACP00000003075 ENSGACP00000003075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]