SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003080 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003080
Domain Number 1 Region: 260-359
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-27
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003080
Domain Number - Region: 150-230
Classification Level Classification E-value
Superfamily MW0975(SA0943)-like 0.0589
Family MW0975(SA0943)-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003080   Gene: ENSGACG00000002362   Transcript: ENSGACT00000003091
Sequence length 370
Comment pep:known_by_projection group:BROADS1:groupXXI:4321112:4328506:1 gene:ENSGACG00000002362 transcript:ENSGACT00000003091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKRSDREVGSHLSDTLPRKKTTPITTPQFMCATLGRSYPTKAHHPLVQSTSCGSILP
RMFSLSNKESDSRRLQKGMQTITLSLSHFYKTGQPGSRAASQNNVYLDAFGYRDNQAFDT
MSVDSTDSVDTSISACSPDNVSSASTSNMVKLEEMERLLREAQAEKSRLLEYKDQEMEVR
KQALDEERKRREDLEKRLQEETSRRQKLIDREVKLREKQRAQSRPLTRYLPVRKDDFDLR
AHIESAGHSTDTCFHLSISEKTCRGYLIKMGGKIKTWKKRWFVFDRNRRTLSYYSDKHEA
KLKGVIYFQAIEEVYYDHLKNAHKSPNPSLTFSVKTHDRVYYMVAPSPEAMRIWMDVIVT
GAEGYTQFMV
Download sequence
Identical sequences G3NCN0
ENSGACP00000003080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]