SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003090 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003090
Domain Number 1 Region: 338-433
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-23
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 43-189
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-20
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003090   Gene: ENSGACG00000002354   Transcript: ENSGACT00000003101
Sequence length 2077
Comment pep:novel scaffold:BROADS1:scaffold_54:1145367:1175479:-1 gene:ENSGACG00000002354 transcript:ENSGACT00000003101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAKENPCRKFQANFFNKSKCQNCFKPRELHLLTDQDLTQAKPIYGGWLCLAPEGTDFE
NPTQRSRKWQRRFFVLYEHGCLRFALDESPSTLPQGTVNMNLCTDVIDSEPKTGQKNSLC
IITPDQEYFIRGENKEIINGWSEQLVVYPQTNKQNQKKKRKVEPTTSQEPGPAKVAVTGS
GIPEAEKVPNSSSLIWQEELNQREAEGAPVWAPDLPPGSPLPPAAVLQTVAELENMEDRI
VPSGDKYDVKEDPCERTGYQSLAQMTRLMRIDQKWPPAYSPPTAYSCRSGVIEKLEALEL
ENPEKMEVEELSRRGGRQGRSEHRGFHREKNPDLLNFKKGWMVRLDAHGQWKKYWFVLTD
HSLRYYRDSIAEEASDLDGEIDLSTCYSVTEYQAQRNYGFQIHTREGVHTLSAMTAGIRR
NWIQAVMKNVRPSAAPDVASSTEAGGSSGLPEAAGPDVTRDSICSEALPAGRESTPAVAK
SRARERRREGRSKTFDWAQFRPIAQALAQQRAEEAGGLRADLDHLERSVRREDRWRRRES
VSGSSSEQTSAHQGGRKDCEGGDAAQQSASPVGGKQRVEEEIEQHWQQLEKTPIREERRV
PLHSRDTAELQQLLENHNLLSAIEDLKAQLERCHQQLVDSNRHKQELELQLRTSPDVRTG
YISPENIKQTDFQAATRLHRCMSSLHADVTPQTKRPELVSSQAQSLTRKYQETKELLKLH
ELKKRNMQAQLGPALSHPPMKEPYLSEPPTAAPALGGPPHEVVQKTTSFPSEDSIGAIQE
PDSSSAGKPLSLLELEQLSGCRRCNEETAETHQLLKLLESWKYQRDKRSLAVAGGSIQQY
QTCFFTLEDFFSKVENPRFRSPCSPLLGTDDHSEADQVTHGMLSQRIDLWTIENGALKQR
RQQIINQLIAADREIDKLEAELIGQQGGRQHHTGREELKGELAGKQAYEIDRGYNERELS
ENALTTLEKLGDTENQPQSNGADYGEEEPNKALLQVANAMVVWMKADPQSAEQRILKLEA
RNGELMTLNLECETVRRMELREAESKIRMLKEKAEEVERTLGQCVEADDGGLMKQPVTEV
ERKSGAINQVLQMLAKVAVTVDELLWDLEGTLLGYSKEEPLHVELGMGAGFWNQLLFSSE
IQSEEKTDGCAAGLAQQMRAQTRLMLLTRRTSPPAEAEIERVTEQDVAAMYRWLEQETRA
FILREKTDTLAAKSNVSTQAASNVKLAKDEQVVSLALTSFASDDEKKRTSQHLWTEAQMS
YVISRLEVQQEKELDEKQAELQISRLDCTYCHELWKATKDLQSKLADLQIQPSVASLKSA
AGHKASVRGGKPIDAPNRSNELDDAIARHSEELEDVTDGYEQEADTLTLRVPSEENVKEI
KSLANGVENIKKRTTPMETFVEEMEELRSTTKPTTPDVNSTDEDPPAQTSPPEEAVRVPA
DVTQEMRRDITALRLKYQKDLENLKVEALLLLAVLHPLWHPQMPLPRCMKTNLLRVNVRL
DKYPSCFVYLKAGVYSVFFLQDHQVRACLLCSYCLIKVHKHCMEEDFTDASLTTNVHRED
QCNQGNGPSLTIVCYYVLSSSIWPSRCLNVPECPRVLMHSGTSNSNLMSEQDVYLGRFSH
DRSSLGRSSGGFISALWTSISPVAGSRSRQRPVHRRSPRISCRLLVEVFSWVCGTLHTSY
ITSVIARLNTFFINVIDERFPLGGRCLRGVTRLSLCVVKPLCTHSSSTFPPLTGCSLHVV
LDEEGLCCVAQGSFLPGFHAQRATCERGFTAMEVSHQKVIDELQRKHQRELENLHEEKER
LLAEETAATIAAIEAMKNAHRAELEKELDKARKANNNTENADIEEIRRQHEEELCSFQRE
IEVLSDQYSQKCLENAHLAQALEAERQALRQCQRENQELNAHNQELNNRLAAEITKMRSM
ASEDGGGDTHTTIQGKELYELEVMLRVKESEVQYLKQEINSLKEELQAAQRDKKYATDKY
KDIYTELSIVKAKAERDLGRLRDQLQAAHEALGEASLEEVERGGYDIMKSKSNPDILKMA
AAAAKRSERTMRSKSLKEGLTAEQRLHLFENEDAKEF
Download sequence
Identical sequences G3NCP0
ENSGACP00000003090 ENSGACP00000003090 69293.ENSGACP00000003090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]