SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003138 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003138
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily PH domain-like 5.7e-45
Family Phosphotyrosine-binding domain (PTB) 0.00044
Further Details:      
 
Domain Number 2 Region: 149-185
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0000248
Family Mitotic arrest deficient-like 1, Mad1 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003138   Gene: ENSGACG00000002401   Transcript: ENSGACT00000003149
Sequence length 289
Comment pep:known_by_projection group:BROADS1:groupXVI:5748920:5803548:1 gene:ENSGACG00000002401 transcript:ENSGACT00000003149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTPEALAKHYIPYNVKFLGNTEVETPKGTEVVKDAVRKLKFQRHIKKSEGLKTPKVELQ
ISIYGVKILDLKTKDVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCFVFDSEKC
AEEITLTIGQAFDLAYKKFLESGGKDVETRKQIGTLQKRIQELETENSELKQQLQDLEEQ
LMISHVSPAGSNSMKPKSTDVFDMVPFSPVTALVPTMASNGCPPPPPTTLPPDMSKDLFG
AEPFDPFTCGSADFPPDIQSKLDEMQEGFKMGLTLEGTVFTLDPLDSRC
Download sequence
Identical sequences G3NCT8
ENSGACP00000003138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]