SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003150 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003150
Domain Number 1 Region: 127-510
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.4e-141
Family Myotubularin-like phosphatases 0.0000000284
Further Details:      
 
Domain Number 2 Region: 6-117
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-20
Family GRAM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003150   Gene: ENSGACG00000002411   Transcript: ENSGACT00000003161
Sequence length 651
Comment pep:known_by_projection group:BROADS1:groupXXI:4687222:4696475:1 gene:ENSGACG00000002411 transcript:ENSGACT00000003161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKVEQVRLLDRFCNKSTNGTLYLTATHLIFVESGSNNSTSTAQEIWILHHHIAS
VEKLSLTTTGCPLVIQCRNFRVVHFVVQRERDCHDIYSSLLRLLRPVSYEELYAFSYNPK
QSDQQRDEGWQLIDLGAEFERMGVPCDQWQLTNVNRDYKVCETYPRDLYVPITASKPIIV
GSSKFRSKGRFPVLTYFYQEKKAAVCRCSQPLSGFSARCLEDESMLQAISKANHNSQFVY
VMDTRPKLNALANRAAGKGYENEDNYSNIRFQFVGIENIHVMRTSLQKLLEVIGSRSVSM
SDHLVGLESSGWLRHIKAVIDAAIFLSKAVTVEGASVLVHCSDGWDRTSQVCSLGALLMD
PYYRTIKGFMVVLIEKDWISFGHKFADRCDQLDGDPKEVSPIFTQFLECVWQLTEQFPQA
FEFSDWFLLQIHEHVHSCQYGNFLGNNQRQREDLRLRERTHSLWAYLMSEKQMYSNPFYS
AAYSESHPVLEPSTLPYHFKFWRNMYHQFDRSMHPRQSVLKTVLTLRENSREAESTLQAL
QDRLHQLGATPVVTSDPAPPTRDQRSNTLPPRPDSLILGAAINDKEVQRQANERQQQAVE
STDTERTVEGSSGTESRKQSYGELEGTYNSELAKEEPAVVSLEFGVARMTC
Download sequence
Identical sequences G3NCV0
ENSGACP00000003150 ENSGACP00000003150 69293.ENSGACP00000003150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]