SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003253 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003253
Domain Number 1 Region: 16-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000119
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003253
Domain Number - Region: 163-220
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00136
Family Ubiquitin-related 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003253   Gene: ENSGACG00000002494   Transcript: ENSGACT00000003264
Sequence length 334
Comment pep:known_by_projection group:BROADS1:groupXXI:5618122:5622349:-1 gene:ENSGACG00000002494 transcript:ENSGACT00000003264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKMCIVRYLEASKYCPICDV
QVHKTKPLLNIRSDKTLQDIVYKLVPGLFKSEMKRRRDFYAEHPVDASNGSNEDRGEVAD
EDKRIITDDEIISLSIEFFDHSRERNVCLPKESFPNVQVANKRYLQCPAAMTIMHLRKFL
RSKMDIPNAYQVEVMYEDEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPNCKKMKVSHA
QQEGQSSASRSGPESDSASDKAGSPAGAPSTSSSLPSPGTPARSPQLPHGPVKVNGTPAA
PPTPSRSFTPFGGGGGGGNKARKVSLNGSSTSSG
Download sequence
Identical sequences G3ND53
ENSGACP00000003253 ENSGACP00000003253 69293.ENSGACP00000003253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]