SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003271 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003271
Domain Number 1 Region: 26-91
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000269
Family PHD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003271   Gene: ENSGACG00000002505   Transcript: ENSGACT00000003282
Sequence length 1075
Comment pep:known_by_projection group:BROADS1:groupXXI:5653839:5689259:-1 gene:ENSGACG00000002505 transcript:ENSGACT00000003282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSERCLAADDKLPRKKNNMKEMIGGCCVCSDERGWAENPLVYCDGHGCNVAVHQACYG
IVQVPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVEFANV
STMEPIVLQSVPHDRYNKTCYICEDQGRESKAASGACMTCNKHGCRQAFHVTCAQFAGLL
CEEQGSDADNVKYCGYCKYHHSKLVSRRSRGRGSMCQLSGSSSQCVERPPDMDKKKHKER
DRHKPKHKKISMDMSPSLVLPNILVPDKTYNSGNSGGGVTSLPASSQKRLDDGTARFTTA
NFQEVSSALGGGPKDGSPADAGKAASEVKNKKSGGVGHVAGQRGGRKSLTSSGKPLPSAD
FDQTPGRVVASKTPSAPSSSDFLSFSDSALRSGGGTTFSSPPSFSSCLVKPCSEGGASEG
TTALFGSMIHTATETTSLGGPAGYKRPQPSSSLPGIGGAAAGGGGDDGVKKKKKGNWRNR
FGPCFTTDVKASEPAPSLTIPSSSTANTTAPTSSSSTASTSSSSSSTLTGRPGMVSSRGS
GSWVSPVGFRTSGMGVCRAAAPQRAGQVRKPVAHTKHNSNDELLSHRSVSQLYLNGDIIA
KLQINQVPSTHKYSPAAPSQVSLVDPFKCTADPDGLPASVFNLASSHMFGNRLNPNSAMA
ALIAQSEASPADQEVGDGGVGSQGFSIRASPKTTPRSPIGGLQIRYDSSGSLPGPGLGLL
GAGGGGGEALPPVATSIEQLLERQWNEGQSFLLQQGTQGDVVGMLKSLHQLQEENRRLEE
QIKTLTLKKERLQLLSAQLSVPFTSSMISGTQTHTHTHTCTDTGAETFTLAINLTPSSMA
FLPLSQDGASCGGHSSSGSTSSLSTPPSVSQSPPQLNGVAAAATGPGRLGGVAGLIGALG
AGSALGMAGIVGALNGVIQTPPGTTGAAAGATLPWVEAYCAHCELCLCLVSAARLGLLSE
QHRLLQQHQLQQLLSSHPSAEQQQVFFYQLMQQQQQDLQQLQSLSSSAQIPSIPLSCPQL
PVGNLLPSAQSQGQGTITANPFLAMQHAHGDAHASGAQKARLAEKAVGVAGQEKT
Download sequence
Identical sequences G3ND71
ENSGACP00000003271 69293.ENSGACP00000003271 ENSGACP00000003271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]