SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003333 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003333
Domain Number 1 Region: 333-400
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000247
Family IBR domain 0.022
Further Details:      
 
Domain Number 2 Region: 415-478
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000141
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 58-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000353
Family Ubiquitin-related 0.019
Further Details:      
 
Domain Number 4 Region: 176-202
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000255
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 
Domain Number 5 Region: 259-307
Classification Level Classification E-value
Superfamily RING/U-box 0.00000053
Family RING finger domain, C3HC4 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003333   Gene: ENSGACG00000002544   Transcript: ENSGACT00000003344
Sequence length 492
Comment pep:known_by_projection group:BROADS1:groupXXI:5790938:5795815:-1 gene:ENSGACG00000002544 transcript:ENSGACT00000003344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCIELTRAIEAGDTQSASDFAATLARQHAALKIQPSAKDYEDTEINLAVAVEDSSSSCCV
TVKVSPHMTTAALKQQMFLEYGFHPRVQRWVIGQCLCTDQRSLASYGVRQDGDTAFLYLL
SARHARLTFQVLQRDQESALLLGPQSLSLPGPHLAATAANGAPSPARRPYATLPPRLGWS
CPSCTYINKPTRPGCEICSTNRPDSYVIPGGYRPDALELRRIQQEKEAVRQYQQAREKER
GENFARLVMMDGRDLLPNPESVDCRICYVDLKPGEGVLLRECLHCFCRECLCSVIMLSEE
PEVACPYRDDTYSCTCSLQEREIRALVPAEEYERWLQRGLSVAESRCEGSYHCATPDCPG
WCVYEDTVNVFHCPVCRKHNCLICKSIHEGMNCKQYQDDLAARAMNDSAARRTTHLLKTL
VQSGEAMHCPQCGIIVQKRDGCDWLRCTVCHIEICWVTRGPRWGPTGPGDTSGGCRCNVN
NQKCHPKCQNCH
Download sequence
Identical sequences G3NDD3
ENSGACP00000003333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]