SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003339 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003339
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.75e-26
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003339   Gene: ENSGACG00000002551   Transcript: ENSGACT00000003350
Sequence length 822
Comment pep:known_by_projection group:BROADS1:groupXXI:5808646:5870440:-1 gene:ENSGACG00000002551 transcript:ENSGACT00000003350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKLDLSGLTDDEAEHVLKVVQRDMKLRKKEEERLSFSEMKQELAEEGSRCSILSKQHR
FNEHCCIRCCAPFTFLLNPKRLCLDCQYNVCKTCCTYNKKDKAWLCSACQKGRVLRTQSL
EWYYNNVKSRFKRFGSAKVLKTLYRKHIIERGALSDLPESSVHEGSNDNDGSICGSDSAF
YKQSEALLKATAWQKTSQSPLRVAERAIEEPLTRSKSLPPLVETRLFWRYLQDHKEELIE
ELATTIVQKIIQRRKRSEMQTEYDSVWPQTHSLIQPSDLPSPSQPQASSVESGLWRSRSA
FSLTSDDSPDKGPEEVQEYAPLKREAKAASLPTWKSVDRLDNSSASSVLQSPDGNWIALH
SSQLSRPSLLTKRKSLVFSVLEKESGVASAYDGMGSDSEENDAGGWGAALRQFRRRLSDD
TYYTDSQHDPEWTYTQHLPVTSPSSGQYTNTETLNSDSEASSVPPACPRKPPHNLLRRKG
PPDAHLHPHHQPLYHQHQHQNVSPYPLHSEALDVNFNPKVMGDSSEAEERQSDPVRRSRR
RRKSKRESTAEQSKEESAPDTTPTATATPDKSDAITPEPEDLDTVDPNQGPGDPLEEELR
SRLSHFARRAKSRDSSSSEEQEKPPKVRMKNSLKAQLCFVGSKQEVKVELMKQKYSAASL
CSITTEVLKVLNATEELIGEAGGDRHNPSESVSASPFSSSSETRKLDQRLTKMEENVYLA
AGAVYGLEGALGHLEQCARGIESGTADAELAFLEDQVATAAAQVQQSELQISNIEARISA
LKTAGMNVTVCNHFSKFKPKAKPQTLDSSRHQRRKLPAPPLK
Download sequence
Identical sequences G3NDD9
69293.ENSGACP00000003339 ENSGACP00000003339 ENSGACP00000003339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]