SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003470 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003470
Domain Number 1 Region: 599-664,702-800
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-27
Family Pleckstrin-homology domain (PH domain) 0.0065
Further Details:      
 
Domain Number 2 Region: 1218-1348
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-22
Family Second domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 816-929
Classification Level Classification E-value
Superfamily PH domain-like 5.09e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003470
Domain Number - Region: 1349-1445
Classification Level Classification E-value
Superfamily PH domain-like 0.000713
Family Third domain of FERM 0.027
Further Details:      
 
Domain Number - Region: 39-172
Classification Level Classification E-value
Superfamily Tropomyosin 0.0248
Family Tropomyosin 0.0069
Further Details:      
 
Domain Number - Region: 1120-1199
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0439
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003470   Gene: ENSGACG00000002649   Transcript: ENSGACT00000003482
Sequence length 1494
Comment pep:known_by_projection group:BROADS1:groupVI:1057007:1077203:-1 gene:ENSGACG00000002649 transcript:ENSGACT00000003482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEEAMSQEVWKEKCVVLEALLMKFRVQVIKIRELTADKIQQLETQVTDAEKRAFADH
QQVQWMEEKLKASDSQSGDSEVRLFRRCQELQALLQEKEDVIAQLEQQLEEQKQIRLQDA
KTVEEKAAKIKEWVMLKLSEFEMENAALRETNKQQEAQIGELQKQVQSLEQKCGGGREVL
CKPGEAKRLSSLTFGCFQVRGKSPQVLVGPAPCQRTVSSQEETEGRDTTKLTYGSLQRQM
SKNNSAKRYLTAAASMSALTEEASSGTNGEVRTPDPTGPQEGDSAFESLGGSAHRPESRG
VSSVLSSAASDGGGAGRGGGGGGGPESSRPGSETYLTASDDSSSLFDDDMQRAERPGFGL
LGAPDGMLGGYKGEAEEEAHGAKLEDLTSEELNKRFKSQRLDSSSSSGEGNTPSPILTPA
LTPKRANSLRTRGPASPKQPRLRTPAGFGLTNAALAKRHLSQPPTSTEAPQGRTRNALSM
LRTLRPQEADLDQEQRVGMETAREMPPQSSRAGHAFTALQTSRGLPEPGAEVGGDISAPP
TPPLHRLPSWERRIYAVAKSGIRLSETSCTGPTTKDPSLLSSYPAFAMYTSLVYKNMTAP
VYTTLKGKATLLSSSPLSDESSSSEESSSSGEEDGSLCSSRASSSSRRDGSPRSLKRAVS
MSSMTSESDYAIPPDAYSTDTECPEPEQKLPKTCSSDGDRSVSEPMEKSGYLLKMVKTWK
KTWKRRWFVLKDGELLYYNSPSDVIRKPQGQIEVNATSSIARGDGKQVLQVVTGKRVCYL
KADSPNLLEEWLRVLQSVLRLKAASPLFTQPDIRPGMKGLLIKVKHGYSKRVWCALIGKT
LYYFRSQEDKFPLGQIKLWEARVEEVDRTKDSCDDLKACGRGLDAAHFILAVHPQEQGPT
YLLIESRHEKESWLYHLSVAAGAAVSKVGTEFEQLVGKLFQLDGDPDSQIWRHPMLCFSK
EALLSPLTTLPSQALQTEAVKLFKTCQLFVNVAIDAPAIDYHVSLAQSALQVGLAHPELQ
NEFFCQLIKQTQRRPQGHPGPLQGWQFLALCVGLFLPQHPFLWLLQVHLKRHGDSRTEVG
KYAVYCQRSLERTQQKGERQARPSRMEILSILLRNPYHHSLPFSVPVHFLNNTYQVVSFD
ASTTVDEFQCRLNQDSGIRKTGLSCFSLYTDDPTGRELEHCLQGGIKICDIISKWEQASK
EQHTGKSENTRTVRLTYKNRLYFSLQVRWESERERLLLAYQTNEAIVAGHFPVNKELALE
MAALLAQVEFGDFERPFSAPGPAQTKSNQTLKQVLDRFYPKHYRKTMSEEQLRQLLQRLS
ARWASLRGRSSSECVRIYLTVARKWPFFGAKLFEVESITSSPEQGARVWLAVHEDGVSVL
EHSSVKPLASHSYRNLMTFGGYKQYFMLLVGQNTNGSKEKPTEKHLFATDASKIREITLL
VSSYVNSAHQQKAAAHHLSAPALMAAQPVSLKSKELRSKSPPPLGRPGKTPTLL
Download sequence
Identical sequences G3NDS0
69293.ENSGACP00000003470 ENSGACP00000003470 ENSGACP00000003470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]