SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003547 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003547
Domain Number 1 Region: 131-250
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-34
Family Phosphotyrosine-binding domain (PTB) 0.0000282
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-16
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003547   Gene: ENSGACG00000002710   Transcript: ENSGACT00000003559
Sequence length 293
Comment pep:known_by_projection group:BROADS1:groupXXI:6446899:6474452:-1 gene:ENSGACG00000002710 transcript:ENSGACT00000003559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFNDIVKQGYVRIRSKKLGIFRRCWLVFKKASSKGPRRLEKYPDEKAAYFRNFHKNT
ELHNVKNITRMPRETKKHAVAIIFCDDTSKTFACESELDAEEWCKLLCVECLGSRLNDIS
LGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWDIHNARLKLVMWP
LSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQRVHSATLAIAQQHERMMEE
MEKSSQKAVNTGIHPRETLTKSISLPRSAYWQHITRQNSVGDLYSYQGRGMQS
Download sequence
Identical sequences G3NDZ6
ENSGACP00000003547 69293.ENSGACP00000003547 ENSGACP00000003547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]